Lus10021410 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28190 272 / 3e-93 CZSOD2, CSD2 copper/zinc superoxide dismutase 2 (.1)
AT1G08830 191 / 2e-62 CSD1 copper/zinc superoxide dismutase 1 (.1.2)
AT5G18100 177 / 7e-57 CSD3 copper/zinc superoxide dismutase 3 (.1.2)
AT1G12520 60 / 4e-11 ATCCS, CCS1 copper chaperone for SOD1 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016155 312 / 5e-109 AT2G28190 308 / 1e-107 copper/zinc superoxide dismutase 2 (.1)
Lus10004139 188 / 4e-61 AT1G08830 253 / 4e-88 copper/zinc superoxide dismutase 1 (.1.2)
Lus10001719 187 / 4e-59 AT1G08830 250 / 6e-85 copper/zinc superoxide dismutase 1 (.1.2)
Lus10010651 176 / 1e-53 AT5G18100 228 / 9e-75 copper/zinc superoxide dismutase 3 (.1.2)
Lus10013615 160 / 3e-48 AT5G18100 209 / 7e-68 copper/zinc superoxide dismutase 3 (.1.2)
Lus10007031 58 / 7e-10 AT1G12520 399 / 5e-140 copper chaperone for SOD1 (.1.2.3)
Lus10006686 57 / 1e-09 AT1G12520 393 / 6e-138 copper chaperone for SOD1 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G216700 266 / 7e-91 AT2G28190 267 / 2e-91 copper/zinc superoxide dismutase 2 (.1)
Potri.009G005100 257 / 3e-87 AT2G28190 252 / 2e-85 copper/zinc superoxide dismutase 2 (.1)
Potri.013G031100 192 / 7e-63 AT1G08830 261 / 6e-91 copper/zinc superoxide dismutase 1 (.1.2)
Potri.005G044400 191 / 3e-62 AT1G08830 266 / 5e-93 copper/zinc superoxide dismutase 1 (.1.2)
Potri.013G056900 181 / 3e-58 AT5G18100 239 / 4e-82 copper/zinc superoxide dismutase 3 (.1.2)
Potri.019G035800 177 / 1e-56 AT5G18100 237 / 3e-81 copper/zinc superoxide dismutase 3 (.1.2)
Potri.009G163200 62 / 1e-11 AT2G28190 46 / 2e-06 copper/zinc superoxide dismutase 2 (.1)
Potri.001G113800 56 / 3e-09 AT1G12520 377 / 2e-131 copper chaperone for SOD1 (.1.2.3)
Potri.003G118400 54 / 1e-08 AT1G12520 393 / 8e-138 copper chaperone for SOD1 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Representative CDS sequence
>Lus10021410 pacid=23179173 polypeptide=Lus10021410 locus=Lus10021410.g ID=Lus10021410.BGIv1.0 annot-version=v1.0
ATGCAAGCAGCTGCAGCTGCAGCCATGGCGGCACACACAATCCTATCAACACCCCCGTCATTCCACTCCTTCCTCTCTCCCCTTTCAATTCCGGCTGCTC
TCCACTCCACCGTCTCCCTCAGCTTCCCTCTTCGCCAACCGATCTCTTCACTCTCCCTCTCCGCTCCGGCCGCAGCCAAGAAGAAGCCTCTCACAGTCGC
AGATGCCGCCAAGAAGGCCGTTGCCGTTATGAAGGGCACCTCTGACGTTGAAGGCGTCGTCACTCTGACTCAGGAAGATGATGGTCCAACGACTGTAAAT
GTTCGCATCACTGGTCTCACTCCAGGGCCGCATGGGTTTCACTTGCATGAGTACGGTGACACAACGAATGGCTGCATTTCGACAGGACCGCATTTCAATC
CTAACAACTTGACACATGGGGCTCCTGAAGACGAAGTCCGACATGCAGGTGACCTGGGAAACATAATTGCCAATGCTGATGGAGTAGCAGAGGCAACAAT
CGTGGACAAACAGATACCTCTGACTGGTCCGAATGCGGTAGTTGGAAGGGCTTTCGTTGTCCATGAGCTCGCGGATGATCTTGGAAAAGGTGGGCATGAG
CTTAGTCTGAGCACAGGCAATGCCGGAGGTAGATTGGCATGCGGTGTCGTTGGGTTGACGCCGGTGTAA
AA sequence
>Lus10021410 pacid=23179173 polypeptide=Lus10021410 locus=Lus10021410.g ID=Lus10021410.BGIv1.0 annot-version=v1.0
MQAAAAAAMAAHTILSTPPSFHSFLSPLSIPAALHSTVSLSFPLRQPISSLSLSAPAAAKKKPLTVADAAKKAVAVMKGTSDVEGVVTLTQEDDGPTTVN
VRITGLTPGPHGFHLHEYGDTTNGCISTGPHFNPNNLTHGAPEDEVRHAGDLGNIIANADGVAEATIVDKQIPLTGPNAVVGRAFVVHELADDLGKGGHE
LSLSTGNAGGRLACGVVGLTPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Lus10021410 0 1
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10010909 2.6 0.8956
AT5G16710 DHAR3 dehydroascorbate reductase 1 (... Lus10009135 4.7 0.8708
AT3G20680 Domain of unknown function (DU... Lus10006345 6.3 0.8586
AT5G19020 MEF18 mitochondrial editing factor ... Lus10034022 8.4 0.8281
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10031423 8.5 0.8286
AT2G32070 Polynucleotidyl transferase, r... Lus10003635 8.8 0.8396
AT5G67220 FMN-linked oxidoreductases sup... Lus10006260 8.9 0.8146
AT1G51370 F-box/RNI-like/FBD-like domain... Lus10027020 9.2 0.8405
AT1G26761 Arabinanase/levansucrase/inver... Lus10037153 9.5 0.8510
AT2G47450 CPSRP43, CAO CHLOROPLAST SIGNAL RECOGNITION... Lus10025111 11.0 0.7797

Lus10021410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.