Lus10021422 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36870 395 / 2e-139 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G44990 394 / 6e-139 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT1G14720 205 / 3e-64 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT1G32170 202 / 3e-63 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT4G18990 198 / 3e-61 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT3G25050 195 / 8e-61 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT2G01850 195 / 2e-60 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT1G10550 193 / 6e-60 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT5G57550 188 / 4e-58 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57560 187 / 4e-58 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016144 530 / 0 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10041341 469 / 2e-168 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10037377 463 / 3e-166 AT2G36870 422 / 9e-150 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10023009 377 / 4e-132 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10001396 376 / 1e-131 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026535 373 / 1e-130 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 372 / 2e-130 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026536 322 / 5e-110 AT2G36870 402 / 1e-141 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013823 245 / 2e-81 AT2G36870 301 / 7e-104 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G006600 412 / 5e-146 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.006G122900 396 / 6e-140 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 390 / 1e-137 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G163850 216 / 3e-69 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.010G102300 201 / 1e-62 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.003G097300 200 / 4e-62 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.001G136100 200 / 5e-62 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.008G138400 198 / 1e-61 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.013G152400 191 / 4e-59 AT4G03210 442 / 2e-158 xyloglucan endotransglucosylase/hydrolase 9 (.1.2)
Potri.014G115000 189 / 3e-58 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10021422 pacid=23179194 polypeptide=Lus10021422 locus=Lus10021422.g ID=Lus10021422.BGIv1.0 annot-version=v1.0
ATGGCTACCACTAATGTTCTTCTTCCTTCTCTACTATTACCTCTCTTCTTGCTAGCCCAAGTACTCTTTGCTCAAGACTACCCCCCTAACCCCGGCTACT
ACCCGAGCTCGAGAGCTCCTTCCATCCCTTTTGATAGAAGGTATCAAAACCGATGGGGTCCTCAGCACCAAAGGCTCGACCAGAACTCGGTGACCATTTG
GTTAGACCGCTCTTCAGGAAGTGGGTACCAATCACTTAAGCCATACAAATCTGGCTACTTTGGTGCTTCCATCAAGCTTCATCCGGGCTATACTGCTGGA
GTCATCACATCTTTCTACCTATCGAACAACGAGGTTCATCCAGGGAACCACGACGAGATCGACATTGAGTTCTTGGGAACCACGCCCGGGAAGCCGTACA
CATTGCAGACCAATGTGTACGTTAGGGGAAGTGGGGATAGGAACATTGTAGGCAGAGAAGTGCAGTTCCATCTATGGTTTGATCCCACCCAAGACTTTCA
CCACTATGCAATCTTGTGGGACCCTAATGAAATTATATTTTATGTGGACGATGTGCCAATCAGGAGGTATCCAAAGAAAAGCGATGCGACATTCCCACAA
AGACCAATGTGGGTCTACGGGTCGATTTGGGATGCATCCGACTGGGCCACCGAGCACGGTAGGTACAAAGCTGACTACAATTACCAACCTTTCATTGGCC
GGTACAAGGACTTCAAGATCGGAGGTTGCACCGCTTTTGCTAAACCAGGGTGCCAGCCGACTCCTGGGTCTCCGACAGGCTACGGGGAGCTAAGCCAACA
ACAAATGGTGTCTATGTCTTGGGTGCAGAGGAACCATATGGTGTATGACTATTGCAATGACCCACAAAGGGACCATACTCACACTCCTGAGTGCTAG
AA sequence
>Lus10021422 pacid=23179194 polypeptide=Lus10021422 locus=Lus10021422.g ID=Lus10021422.BGIv1.0 annot-version=v1.0
MATTNVLLPSLLLPLFLLAQVLFAQDYPPNPGYYPSSRAPSIPFDRRYQNRWGPQHQRLDQNSVTIWLDRSSGSGYQSLKPYKSGYFGASIKLHPGYTAG
VITSFYLSNNEVHPGNHDEIDIEFLGTTPGKPYTLQTNVYVRGSGDRNIVGREVQFHLWFDPTQDFHHYAILWDPNEIIFYVDDVPIRRYPKKSDATFPQ
RPMWVYGSIWDASDWATEHGRYKADYNYQPFIGRYKDFKIGGCTAFAKPGCQPTPGSPTGYGELSQQQMVSMSWVQRNHMVYDYCNDPQRDHTHTPEC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10021422 0 1
Lus10033259 2.2 0.9269
AT5G02640 unknown protein Lus10038485 3.0 0.9110
AT3G47340 AT-ASN1, DIN6, ... DARK INDUCIBLE 6, ARABIDOPSIS ... Lus10042281 3.3 0.8948
AT2G37030 SAUR-like auxin-responsive pro... Lus10013808 5.1 0.9226
AT5G50260 CEP1 cysteine endopeptidase 1, Cyst... Lus10013674 15.7 0.9077
Lus10005025 15.7 0.8564
AT5G05970 NEDD1 NEURAL PRECURSOR CELL EXPRESSE... Lus10040260 18.5 0.8623
AT1G54730 Major facilitator superfamily ... Lus10029961 21.4 0.9036
AT4G08300 nodulin MtN21 /EamA-like trans... Lus10028030 23.9 0.8836
AT2G37030 SAUR-like auxin-responsive pro... Lus10026521 24.4 0.8969

Lus10021422 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.