Lus10021429 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08110 297 / 3e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
AT1G67280 77 / 2e-17 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
AT1G11840 72 / 3e-15 ATGLX1 glyoxalase I homolog (.1.2.3.4.5.6)
AT2G28420 41 / 0.0001 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016138 383 / 3e-137 AT1G08110 302 / 2e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Lus10043235 78 / 4e-17 AT1G67280 551 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Lus10011115 78 / 5e-17 AT1G67280 543 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Lus10003523 72 / 6e-15 AT1G11840 495 / 5e-174 glyoxalase I homolog (.1.2.3.4.5.6)
Lus10002943 71 / 7e-15 AT1G11840 447 / 5e-160 glyoxalase I homolog (.1.2.3.4.5.6)
Lus10038612 66 / 1e-12 AT1G67280 455 / 4e-161 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Lus10039579 44 / 1e-05 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10000007 39 / 0.0004 AT1G11840 131 / 1e-39 glyoxalase I homolog (.1.2.3.4.5.6)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G007200 327 / 4e-115 AT1G08110 318 / 6e-111 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Potri.004G214966 105 / 1e-29 AT1G08110 110 / 3e-32 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Potri.018G084800 78 / 4e-17 AT1G67280 553 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Potri.006G160600 77 / 7e-17 AT1G67280 571 / 0.0 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Potri.004G013200 75 / 3e-16 AT1G11840 496 / 8e-179 glyoxalase I homolog (.1.2.3.4.5.6)
Potri.018G042100 70 / 4e-14 AT1G67280 488 / 3e-174 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Potri.009G055500 50 / 1e-07 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence
>Lus10021429 pacid=23179167 polypeptide=Lus10021429 locus=Lus10021429.g ID=Lus10021429.BGIv1.0 annot-version=v1.0
ATGGCTGCGACATCGGATTCGAAGGATTCGCCTGCTAACAACCCTGGTCTTCATACTTCGCCTGATGGAGCTACCAAAGGTTACTTCATGCAGCAAACTA
TGTTTCGGATTAAGGACCCGAAAGTTAGCCTTGATTTCTACTCTCGTGTACTGGGGATGTCTTTGCTGAAGAGGCTGGATTTTCCGGAGATGAAGTTTAG
CTTGTACTTCATGGGCTACGAGGATCCTGCATCTATTCCAAGTGATGCTGTAGAAAGAACCGTTTGGGCGTTCGCTAAGAAGGCTACTATTGAGCTAACA
CATAATTGGGGAACCGAAAGTGATCCCGAGTTTAAAGGATATCACAATGGCAATTCGGATCCTCGTGGCTTTGGACATATCGGTATAACTGTTGATGACA
CTTACAAGGCATGTGAGAGATTTGAAAGCCTCGGAGTGGAATTCGTTAAAAAGCCAGATGATGGAAAGATGAAAGGGTTAGCGTTTATCAAGGACCCTGA
TGGCTACTGGATCGAGATCTTCGACCTCAAGAACATGAAAGACGTAGCTAAAGCTGGTGTTGCTTGA
AA sequence
>Lus10021429 pacid=23179167 polypeptide=Lus10021429 locus=Lus10021429.g ID=Lus10021429.BGIv1.0 annot-version=v1.0
MAATSDSKDSPANNPGLHTSPDGATKGYFMQQTMFRIKDPKVSLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDPASIPSDAVERTVWAFAKKATIELT
HNWGTESDPEFKGYHNGNSDPRGFGHIGITVDDTYKACERFESLGVEFVKKPDDGKMKGLAFIKDPDGYWIEIFDLKNMKDVAKAGVA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08110 lactoylglutathione lyase famil... Lus10021429 0 1
AT1G56590 ZIP4 ZIG SUPPRESSOR 4, Clathrin ada... Lus10031432 3.5 0.8641
AT3G47160 RING/U-box superfamily protein... Lus10001209 4.5 0.9144
AT3G61370 Protein of unknown function (D... Lus10027936 5.6 0.8450
AT4G01710 ARPC5, CRK CROOKED, ARP2/3 complex 16 kDa... Lus10042895 5.8 0.8976
AT1G48160 signal recognition particle 19... Lus10043056 9.5 0.8138
AT1G50440 RING/FYVE/PHD zinc finger supe... Lus10033381 11.0 0.8829
AT5G10860 CBSX3 CBS domain containing protein ... Lus10019117 11.6 0.8835
AT5G62980 FOLB2 Dihydroneopterin aldolase (.1) Lus10021252 12.2 0.8598
AT5G13240 transcription regulators (.1) Lus10007961 13.8 0.8800
AT5G64816 unknown protein Lus10009081 14.9 0.8640

Lus10021429 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.