Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45020 201 / 4e-68 Ribosomal L18p/L5e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016132 [exp] 241 / 7e-84 AT3G45020 196 / 5e-66 Ribosomal L18p/L5e family protein (.1) Lus10031487 [exp] 50 / 8e-09 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1) Lus10015194 [exp] 50 / 8e-09 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1) Lus10001727 [exp] 38 / 0.0007 AT1G08845 268 / 1e-92 Ribosomal L18p/L5e family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G214400 [exp] 209 / 4e-71 AT3G45020 194 / 2e-65 Ribosomal L18p/L5e family protein (.1) Potri.017G030200 [exp] 40 / 4e-05 AT2G43310 154 / 1e-49 Ribosomal L18p/L5e family protein (.1) Potri.007G128100 [exp] 38 / 0.0005 AT2G43310 129 / 1e-39 Ribosomal L18p/L5e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0267 [flax] [poplar] S11_L18p PF00861 [flax] [poplar] Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence Show only first row Show all	>Lus10021433 pacid=23179258 polypeptide=Lus10021433 locus=Lus10021433.g ID=Lus10021433.BGIv1.0 annot-version=v1.0 ATGACTGTGTTGAAGAGGTACGTCCTCAGGCTGTTCATATCACTGAAGTACATAACAGCCAACGTGGTGGACAGGAACAACGGAAGGATAGTGGCGACAG CATCGACAGTCGAGCATTCGATCAAAAACAGCCTCGAGTGCGGCCGGTCGTGCAACGCCAAAGCTGCGACGGTCGTTGGGGAGGTGCTGGCTATGAGGCT TAAGGTGGAAGGACTTGAACATGGGCTGGGAAGAGGGATTCATACTAATGTAAACAAAGAGATAGAGAAGAAGGGGTTTAAGAGTAGTACTAAGGTTTGG GCTATTGTCAATGGCCTTAGGAACAATGGAGTTAAACTTATCCTTGATGATGACAATGTTGAAAATGAATCTTAA
AA sequence Show only first row Show all	>Lus10021433 pacid=23179258 polypeptide=Lus10021433 locus=Lus10021433.g ID=Lus10021433.BGIv1.0 annot-version=v1.0 MTVLKRYVLRLFISLKYITANVVDRNNGRIVATASTVEHSIKNSLECGRSCNAKAATVVGEVLAMRLKVEGLEHGLGRGIHTNVNKEIEKKGFKSSTKVW AIVNGLRNNGVKLILDDDNVENES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45020			Ribosomal L18p/L5e family prot...		Lus10021433 [exp]	0	1
AT2G43760			molybdopterin biosynthesis Moa...		Lus10026805 [exp]	1.4	0.9027
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	2.2	0.8911
AT5G42300		UBL5	ubiquitin-like protein 5 (.1)		Lus10002228 [exp]	2.4	0.9082
AT1G69980			unknown protein		Lus10036679 [exp]	2.4	0.8869
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10015642 [exp]	4.0	0.8940
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	5.5	0.9001
AT5G17060		ATARFB1B	ADP-ribosylation factor B1B (....		Lus10009571 [exp]	5.9	0.8856
AT1G04290			Thioesterase superfamily prote...		Lus10004288 [exp]	7.7	0.8765
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10019084 [exp]	8.4	0.8654
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10017822 [exp]	9.0	0.8827

Compare expression of checked genes

Lus10021433 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.