Lus10021435 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28085 107 / 7e-31 SAUR-like auxin-responsive protein family (.1)
AT3G09870 77 / 6e-19 SAUR-like auxin-responsive protein family (.1)
AT4G34800 69 / 3e-16 SAUR-like auxin-responsive protein family (.1)
AT2G21210 69 / 6e-16 SAUR-like auxin-responsive protein family (.1)
AT4G38860 68 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT4G34760 65 / 3e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34780 64 / 5e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34810 64 / 7e-14 SAUR-like auxin-responsive protein family (.1)
AT1G75580 62 / 2e-13 SAUR-like auxin-responsive protein family (.1)
AT4G34770 62 / 4e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016130 248 / 3e-86 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Lus10016129 199 / 1e-66 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1)
Lus10021436 197 / 5e-66 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Lus10001397 83 / 3e-21 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10030263 77 / 2e-18 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10004014 74 / 1e-17 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 71 / 2e-16 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026531 71 / 2e-16 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Lus10026532 71 / 2e-16 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G226400 105 / 4e-30 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.016G092400 101 / 2e-28 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 91 / 2e-24 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 69 / 5e-16 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127700 69 / 5e-16 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.009G127600 70 / 7e-16 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 67 / 2e-15 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
Potri.009G126000 67 / 3e-15 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1)
Potri.004G165600 66 / 4e-15 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1)
Potri.004G165300 66 / 6e-15 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10021435 pacid=23179231 polypeptide=Lus10021435 locus=Lus10021435.g ID=Lus10021435.BGIv1.0 annot-version=v1.0
ATGGCTCATACTTCAAGCAAGAACAAAGGAAATGGAGGCATGACCAACCTCAAGATAGTGGCAAAGAAGCTTCAAAAGAGCCTCAATTCCTTGGGGAAGA
AGACAACCAATGTCCCCGGGGACGTTAAAGAAGGCCATTTTGCAGTGTTAGCTGTGGAAGGAGTTGAAGAGCCCCGGAGGTTCATTGTACCCTTATCTTA
TCTAACCCATCCTACGTTCTTGAGGCTCTTGGAGAAGGCAGCCGAGGAGTATGGGTTTGATGGCTATGAGGGTGCCCTTGTGGTCCCTTGTAGACCATCA
GAGCTCGAGAGGATCCTGGCAGAGCAATGGAAAGAAACAAGGTCGACTACTCGGAGGAGGCACAATGACGGTAGTGATGGTAATTGGAGTAGTTCTTCGT
GTAAGACTATGGTGCCAAGCTTTTGA
AA sequence
>Lus10021435 pacid=23179231 polypeptide=Lus10021435 locus=Lus10021435.g ID=Lus10021435.BGIv1.0 annot-version=v1.0
MAHTSSKNKGNGGMTNLKIVAKKLQKSLNSLGKKTTNVPGDVKEGHFAVLAVEGVEEPRRFIVPLSYLTHPTFLRLLEKAAEEYGFDGYEGALVVPCRPS
ELERILAEQWKETRSTTRRRHNDGSDGNWSSSSCKTMVPSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28085 SAUR-like auxin-responsive pro... Lus10021435 0 1
AT3G12160 AtRABA4d ARABIDOPSIS THALIANA RAB GTPAS... Lus10016284 1.0 0.9974
AT5G49340 TBL4 TRICHOME BIREFRINGENCE-LIKE 4 ... Lus10037726 1.4 0.9972
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008935 2.4 0.9858
AT5G60330 unknown protein Lus10018274 3.0 0.9957
AT4G28110 MYB ATMYB41 myb domain protein 41 (.1) Lus10033738 5.0 0.9861
AT1G01470 LSR3, LEA14 LIGHT STRESS-REGULATED 3, LATE... Lus10010140 8.1 0.9735
AT4G28110 MYB ATMYB41 myb domain protein 41 (.1) Lus10031607 8.2 0.9866
AT4G03010 RNI-like superfamily protein (... Lus10033744 10.0 0.9814
AT1G22130 MADS AGL104 AGAMOUS-like 104 (.1) Lus10022506 10.6 0.9784
Lus10032468 11.1 0.9754

Lus10021435 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.