Lus10021436 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28085 117 / 1e-34 SAUR-like auxin-responsive protein family (.1)
AT3G09870 79 / 1e-19 SAUR-like auxin-responsive protein family (.1)
AT4G38860 69 / 7e-16 SAUR-like auxin-responsive protein family (.1)
AT4G34800 67 / 4e-15 SAUR-like auxin-responsive protein family (.1)
AT2G21210 65 / 2e-14 SAUR-like auxin-responsive protein family (.1)
AT4G34770 63 / 1e-13 SAUR-like auxin-responsive protein family (.1)
AT4G34750 64 / 2e-13 SAUR-like auxin-responsive protein family (.1.2)
AT2G46690 63 / 2e-13 SAUR-like auxin-responsive protein family (.1)
AT3G61900 63 / 4e-13 SAUR-like auxin-responsive protein family (.1)
AT3G20220 62 / 4e-13 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016129 234 / 2e-80 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1)
Lus10016130 197 / 6e-66 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Lus10021435 196 / 1e-65 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1)
Lus10001397 77 / 1e-18 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10030263 76 / 3e-18 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10004014 74 / 2e-17 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10013819 74 / 2e-17 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10026532 72 / 7e-17 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10026531 70 / 5e-16 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G226400 104 / 1e-29 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.016G092400 100 / 1e-27 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 96 / 3e-26 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.009G127400 72 / 6e-17 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1)
Potri.009G127600 66 / 2e-14 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.009G127700 65 / 2e-14 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
Potri.009G127500 63 / 1e-13 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Potri.004G165300 63 / 1e-13 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 63 / 1e-13 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.004G164400 63 / 1e-13 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10021436 pacid=23179235 polypeptide=Lus10021436 locus=Lus10021436.g ID=Lus10021436.BGIv1.0 annot-version=v1.0
ATGGCTCCTACTACTAACAAGAACAAGGGAAGTGGGGGCATAATCAAGCTCAAGATAGTGGCAAAGAAGCTCCAAAAGAGCCTCAATTCCTTGGGGATCA
AGAAGGAAAACAACGTCCCCGGGGACGTTAAAGAAGGCCACTTTGCGGTTTTAGCTGTTGAAGGAGTTGAAGAGCCCCAGAGGTTCGTGGTGCCCTTGAC
TTATCTCACTCACCCTACGTTCCTGAGGCTCTTGGAGCAGGCTGCGGAGGAGTACGGGTTTGAAGGGCGCGAAGGCGCCCTTGCTGTCCCTTGTAGGCCT
TCGGAGCTCGAGATGATCTTGTCGGAGCAATGGGAAGAAAGCATTGAGTCCTCAAGGGGAAGGATGATGAACAATGGTGGTGGTGGTGATAGTGATAATT
GGGGTTCTTCCTCTTGTAAGACTATGGTGTCAAGCTTTTGA
AA sequence
>Lus10021436 pacid=23179235 polypeptide=Lus10021436 locus=Lus10021436.g ID=Lus10021436.BGIv1.0 annot-version=v1.0
MAPTTNKNKGSGGIIKLKIVAKKLQKSLNSLGIKKENNVPGDVKEGHFAVLAVEGVEEPQRFVVPLTYLTHPTFLRLLEQAAEEYGFEGREGALAVPCRP
SELEMILSEQWEESIESSRGRMMNNGGGGDSDNWGSSSCKTMVSSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28085 SAUR-like auxin-responsive pro... Lus10021436 0 1
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10012570 1.0 0.9447
AT4G25480 AP2_ERF CBF3, DREB1A, A... C-REPEAT BINDING FACTOR 3, de... Lus10024491 2.0 0.9172
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Lus10041674 2.8 0.8860
AT4G25470 AP2_ERF DREB1C, FTQ4, C... FREEZING TOLERANCE QTL 4, DRE/... Lus10017828 3.2 0.8838
AT2G28085 SAUR-like auxin-responsive pro... Lus10016129 3.5 0.8826
AT3G57910 D111/G-patch domain-containing... Lus10021033 5.3 0.8714
AT2G23440 unknown protein Lus10002969 5.7 0.9156
AT2G29120 ATGLR2.7 GLUTAMATE RECEPTOR 2.7, gluta... Lus10026876 5.7 0.8523
AT1G80760 NLM7, NIP6;1 NOD26-like intrinsic protein 6... Lus10041675 6.6 0.8291
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10032159 10.8 0.8062

Lus10021436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.