Lus10021439 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28080 120 / 2e-32 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36970 100 / 5e-25 UDP-Glycosyltransferase superfamily protein (.1)
AT2G31750 45 / 8e-06 UGT74D1 UDP-glucosyl transferase 74D1 (.1)
AT1G22400 42 / 6e-05 ATUGT85A1, UGT85A1 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
AT5G38040 40 / 0.0002 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016126 205 / 1e-64 AT2G28080 551 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10021437 155 / 1e-45 AT2G36970 530 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10016128 152 / 1e-44 AT2G36970 558 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10016127 144 / 3e-42 AT2G36970 426 / 2e-147 UDP-Glycosyltransferase superfamily protein (.1)
Lus10021438 143 / 4e-41 AT2G36970 534 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10010943 54 / 4e-09 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10031388 54 / 5e-09 AT1G22400 644 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10032220 50 / 2e-07 AT1G22380 601 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Lus10024583 49 / 5e-07 AT1G22380 598 / 0.0 UDP-glucosyl transferase 85A3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G214100 127 / 2e-35 AT2G28080 545 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.009G008100 126 / 6e-35 AT2G28080 622 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10021439 pacid=23179154 polypeptide=Lus10021439 locus=Lus10021439.g ID=Lus10021439.BGIv1.0 annot-version=v1.0
ATGGCGGATGAGACACACGGCGGCGGCGCATACGCCATCGTGGTCACTTTCCCGCTTCAAGGCCATGTCATCCCCGCCGTCCACCTCGCCGTCAAGCTCG
CCTCCCAAGATCGAAGAGATGATGTGATAGATTATGTACCAGAAATCAAAAGAATCAAACCGAAAGACACACCATCGCCTCATCAAGAGGATGATGAGAC
CATCATTGTGCACCAAATAACATTTGGGACATTCCATGATGTCAGGAGTGTGGACTTTGCACTAGTTAACACGATCCAAGAGCTCGAACAAGACACATTT
TTGGGTCTAGAACATGTCCATGAAGCCCAAGTCTACGCTATTGGGCCTATCTCCCCACGCGGGTTCACTACAAAGCCAATTACTATGAGCTTGTGGTCTG
AGTCGGATTGCACCCAACGGTTAAACTCCAAGCCACCTGGCTCGGTCCTCTGTGTGTGA
AA sequence
>Lus10021439 pacid=23179154 polypeptide=Lus10021439 locus=Lus10021439.g ID=Lus10021439.BGIv1.0 annot-version=v1.0
MADETHGGGAYAIVVTFPLQGHVIPAVHLAVKLASQDRRDDVIDYVPEIKRIKPKDTPSPHQEDDETIIVHQITFGTFHDVRSVDFALVNTIQELEQDTF
LGLEHVHEAQVYAIGPISPRGFTTKPITMSLWSESDCTQRLNSKPPGSVLCV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28080 UDP-Glycosyltransferase superf... Lus10021439 0 1
AT5G65210 bZIP TGA1 bZIP transcription factor fami... Lus10037550 1.4 0.9532
AT3G01990 ACR6 ACT domain repeat 6 (.1) Lus10012550 2.6 0.9076
AT4G29800 PLP8, PLAIVD ,P... PATATIN-like protein 8 (.1.2) Lus10023512 2.8 0.9235
AT2G24550 unknown protein Lus10020142 5.1 0.9293
AT2G22730 Major facilitator superfamily ... Lus10003528 5.2 0.9244
AT3G56460 GroES-like zinc-binding alcoho... Lus10028988 9.7 0.8878
AT1G18330 MYB RVE7, EPR1 REVEILLE 7, EARLY-PHYTOCHROME-... Lus10031322 10.2 0.9019
AT5G53130 ATCNGC1, CNGC1 CYCLIC NUCLEOTIDE-GATED CHANNE... Lus10003395 10.8 0.9014
AT4G27780 ACBP2 acyl-CoA binding protein 2 (.1... Lus10022382 11.2 0.9131
AT3G07310 Protein of unknown function (D... Lus10025896 13.4 0.9172

Lus10021439 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.