Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016122 [exp] 111 / 3e-32 AT4G24270 45 / 1e-05 EMBRYO DEFECTIVE 140 (.1.2) Lus10017461 [exp] 40 / 2e-05 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G213900 [exp] 65 / 7e-15 ND / Potri.010G226200 [exp] 53 / 2e-10 ND / Potri.008G036000 [exp] 50 / 2e-09 ND / Potri.009G008300 [exp] 47 / 6e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021443 pacid=23179129 polypeptide=Lus10021443 locus=Lus10021443.g ID=Lus10021443.BGIv1.0 annot-version=v1.0 ATGAACTCTTCTTCTCCTCCTCCTTCTTCGTTAAAGGCTCCGATACTCCTTTTGATAGTAGTGATGTTAACACTCGTGGGAACGAGTCAAGGAATTCGTG ACATCCCTCCACGGCCCTCGAGCGGTCCCAGCACTGTGGTTCTTCACAATGTCCCATCACCGAGGAGAAATCATGACTCGAGAGCTCGTGGTGTGTTTGG TAGAAAGGAAGTGAAGAACTGTCTCCCGAAAGGGTTTAGGCACACATCGGCTCCTTCTAGATATGTGAATTATCAACCACTTGGGTTTTGTGTTTGA
AA sequence Show only first row Show all	>Lus10021443 pacid=23179129 polypeptide=Lus10021443 locus=Lus10021443.g ID=Lus10021443.BGIv1.0 annot-version=v1.0 MNSSSPPPSSLKAPILLLIVVMLTLVGTSQGIRDIPPRPSSGPSTVVLHNVPSPRRNHDSRARGVFGRKEVKNCLPKGFRHTSAPSRYVNYQPLGFCV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021443 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010713 [exp]	1.7	0.8307
AT3G59310			Eukaryotic protein of unknown ...		Lus10004060 [exp]	3.2	0.8150
AT5G35400			Pseudouridine synthase family ...		Lus10022949 [exp]	7.5	0.7806
AT4G24270		EMB140	EMBRYO DEFECTIVE 140 (.1.2)		Lus10016122 [exp]	8.3	0.8024
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	10.6	0.8024
AT1G67680			SRP72 RNA-binding domain (.1)		Lus10036924 [exp]	11.0	0.7473
AT5G26620			unknown protein		Lus10031447 [exp]	14.1	0.7332
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10034540 [exp]	18.5	0.7935
AT5G07580	AP2_ERF		Integrase-type DNA-binding sup...		Lus10040167 [exp]	19.2	0.6670
AT2G38025			Cysteine proteinases superfami...		Lus10035535 [exp]	19.5	0.7303

Compare expression of checked genes

Lus10021443 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.