Lus10021445 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28050 65 / 7e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G22960 62 / 1e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G32630 49 / 2e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G01110 48 / 8e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G16710 47 / 9e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G16420 47 / 2e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G55840 45 / 4e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G16010 45 / 8e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G11710 45 / 8e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12300 45 / 9e-06 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039056 52 / 4e-08 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10042016 51 / 5e-08 AT2G32630 600 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10018019 51 / 6e-08 AT2G32630 590 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10000364 50 / 2e-07 AT1G22960 619 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10034616 49 / 3e-07 AT1G22960 617 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10035735 49 / 3e-07 AT4G11690 526 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10026465 49 / 5e-07 AT1G05670 197 / 6e-55 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10027916 48 / 7e-07 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016511 47 / 1e-06 AT5G59600 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G069600 52 / 3e-08 AT4G28010 661 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G008900 51 / 5e-08 AT2G32630 612 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.007G123600 50 / 1e-07 AT1G06710 1248 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G121700 47 / 1e-06 AT4G19890 923 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Potri.006G015900 45 / 4e-06 AT5G64320 878 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G035700 45 / 5e-06 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.009G105600 45 / 8e-06 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G149800 44 / 2e-05 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.002G237100 44 / 2e-05 AT3G02010 967 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.002G030200 44 / 2e-05 AT1G19720 985 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10021445 pacid=23179210 polypeptide=Lus10021445 locus=Lus10021445.g ID=Lus10021445.BGIv1.0 annot-version=v1.0
ATGGATTCGATTCCTGAGTTGACGGAGAAGGAAGAGATGGATTTTGAGGAGAGGACGTATAAGATTGTGATCGACGGGTATGTAGTAAGATGCGGGAAGT
TCGAGGAAGCCGAAAGGATGGTGTTTGAGATGAAAGATAGAGGCTTTGCAGTAGGACTCCATGTTTGGAATCCGATAGTGAGTGAATACTGTAAGAAAGG
TTTCGTCGAGAAAGCGGGATCGTTGTTCGATAAGATGGTGAAGGGTGGGGTTGATTTTGATCAGGCTACGGAGATGATAGGGAGCAGGCGAGTAGTCGTT
GGTGTTTCGATCTGCAGCGAGGTTTGTAGGCGGCTGTGTTTTTTGAATCGGTTTGATAAGGTTAAGGTGCTGGTGGATGTGATGCTGGCTGCGAATGATG
CTGCTGCAAGGTTAGCAACAGAGATTTGCGAAGAAGTCTCGAAGCCAGATATTCGGGAGCCGGTGTAG
AA sequence
>Lus10021445 pacid=23179210 polypeptide=Lus10021445 locus=Lus10021445.g ID=Lus10021445.BGIv1.0 annot-version=v1.0
MDSIPELTEKEEMDFEERTYKIVIDGYVVRCGKFEEAERMVFEMKDRGFAVGLHVWNPIVSEYCKKGFVEKAGSLFDKMVKGGVDFDQATEMIGSRRVVV
GVSICSEVCRRLCFLNRFDKVKVLVDVMLAANDAAARLATEICEEVSKPDIREPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28050 Pentatricopeptide repeat (PPR)... Lus10021445 0 1
AT2G31880 SOBIR1, EVR SUPPRESSOR OF BIR1 1, EVERSHED... Lus10033041 7.5 0.7636
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10003481 16.5 0.7426
AT2G37550 ASP1, AGD7 yeast pde1 suppressor 1, ARF-G... Lus10023765 19.5 0.7381
AT5G66740 Protein of unknown function (D... Lus10026031 23.2 0.7382
AT3G08890 Protein of unknown function, D... Lus10012498 28.4 0.7332
Lus10043100 36.9 0.7157
Lus10038642 37.0 0.7198
AT3G53720 ATCHX20 cation/H+ exchanger 20, cation... Lus10025322 37.6 0.7362
AT5G36930 Disease resistance protein (TI... Lus10007812 40.8 0.7126
Lus10032968 43.1 0.7090

Lus10021445 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.