Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016109 [exp] 227 / 1e-73 ND / Lus10029184 [exp] 74 / 3e-16 AT1G24020 84 / 1e-18 MLP-like protein 423 (.1.2) Lus10029182 [exp] 70 / 5e-15 AT1G24020 88 / 1e-20 MLP-like protein 423 (.1.2) Lus10010702 [exp] 69 / 1e-14 AT1G24020 79 / 4e-17 MLP-like protein 423 (.1.2) Lus10010698 [exp] 65 / 3e-13 AT1G24020 94 / 2e-22 MLP-like protein 423 (.1.2) Lus10029186 [exp] 64 / 6e-13 AT1G24020 78 / 2e-16 MLP-like protein 423 (.1.2) Lus10041636 [exp] 61 / 3e-12 ND / Lus10031082 [exp] 56 / 8e-10 ND / Lus10005397 [exp] 54 / 1e-09 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0066 [flax] [poplar] Trefoil PF07468 [flax] [poplar] Agglutinin Agglutinin domain
Representative CDS sequence Show only first row Show all	>Lus10021453 pacid=23179144 polypeptide=Lus10021453 locus=Lus10021453.g ID=Lus10021453.BGIv1.0 annot-version=v1.0 ATGTCAGGAAACATATTTGCACTGCCAAAACAGTTCACCCTGAAGAGCAAATCTAACGGCAAGTACCTGAAATACGTCGCAGAAGGCCCCCAAAGCGGCC TCCTCCAGTTCTCGGAGGACCATCATTTCAGTCCTTATGCCAAGTTCGAATCGGAGCCTTACTCGAAATCATACAAAACCAAAGAAGAACTCGTCCACCT CAGATGCTTCTACAACAACAAGTACTGGGTCGGTAACTCTGACCACTACATTTCGGGAGACGCTGACGTGTCCGAGGAAGTCAGGTCGAAACCTACATGT ACGCTGTTCAAGCCCGAATTCTTAGACGACCAAGGTCATACCGCAGCTCGACCGTTACGCTAG
AA sequence Show only first row Show all	>Lus10021453 pacid=23179144 polypeptide=Lus10021453 locus=Lus10021453.g ID=Lus10021453.BGIv1.0 annot-version=v1.0 MSGNIFALPKQFTLKSKSNGKYLKYVAEGPQSGLLQFSEDHHFSPYAKFESEPYSKSYKTKEELVHLRCFYNNKYWVGNSDHYISGDADVSEEVRSKPTC TLFKPEFLDDQGHTAARPLR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021453 [exp]	0	1
					Lus10015310 [exp]	1.0	0.9902
AT4G36950		MAPKKK21	mitogen-activated protein kina...		Lus10034246 [exp]	1.4	0.9757
AT5G19730			Pectin lyase-like superfamily ...		Lus10034981 [exp]	1.7	0.9678
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10038525 [exp]	2.0	0.9137
AT5G25250			SPFH/Band 7/PHB domain-contain...		Lus10001944 [exp]	2.6	0.8881
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	3.2	0.8967
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10034247 [exp]	3.5	0.8955
AT2G44820			unknown protein		Lus10026825 [exp]	4.9	0.8810
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Lus10043483 [exp]	5.7	0.8612
AT5G05390		LAC12	laccase 12 (.1)		Lus10040957 [exp]	5.7	0.8330

Compare expression of checked genes

Lus10021453 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.