Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08080 279 / 3e-95 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) AT2G28210 213 / 6e-70 ATACA2 alpha carbonic anhydrase 2 (.1) AT1G08065 213 / 2e-69 ATACA5, ACA5 alpha carbonic anhydrase 5 (.1) AT4G20990 205 / 3e-66 ATACA4, ACA4 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) AT5G04180 179 / 5e-56 ATACA3, ACA3 alpha carbonic anhydrase 3 (.1) AT3G52720 168 / 8e-52 CAH1, ATACA1, ACA1 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) AT4G21000 164 / 1e-50 ATACA6, ACA6 A. THALIANA ALPHA CARBONIC ANHYDRASE 6, alpha carbonic anhydrase 6 (.1) AT5G56330 141 / 1e-40 ATACA8, ACA8 A. THALIANA ALPHA CARBONIC ANHYDRASE 8, alpha carbonic anhydrase 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016104 [exp] 370 / 3e-131 AT1G08080 344 / 7e-120 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10021455 [exp] 337 / 3e-118 AT1G08080 343 / 1e-119 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10016105 [exp] 327 / 4e-114 AT1G08080 333 / 1e-115 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10021454 [exp] 289 / 3e-99 AT1G08080 300 / 1e-102 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10042030 [exp] 239 / 1e-78 AT4G20990 313 / 9e-107 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10018034 [exp] 234 / 3e-77 AT4G20990 248 / 1e-81 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Lus10014412 [exp] 219 / 1e-71 AT1G08080 277 / 2e-93 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10023915 [exp] 218 / 3e-71 AT1G08080 275 / 2e-92 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Lus10018017 [exp] 195 / 3e-61 AT4G20990 240 / 4e-78 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G212800 [exp] 313 / 7e-109 AT1G08080 347 / 3e-121 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Potri.009G010200 [exp] 307 / 2e-106 AT1G08080 342 / 3e-119 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Potri.016G043700 [exp] 226 / 2e-74 AT4G20990 306 / 4e-105 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Potri.006G121900 [exp] 222 / 5e-73 AT1G08080 289 / 4e-98 A. THALIANA ALPHA CARBONIC ANHYDRASE 7, alpha carbonic anhydrase 7 (.1) Potri.006G047400 [exp] 213 / 5e-69 AT4G20990 289 / 4e-98 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Potri.006G047500 [exp] 196 / 1e-62 AT4G20990 276 / 5e-93 A. THALIANA ALPHA CARBONIC ANHYDRASE 4, alpha carbonic anhydrase 4 (.1) Potri.006G212900 [exp] 178 / 1e-55 AT3G52720 261 / 5e-87 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2) Potri.016G079600 [exp] 174 / 6e-54 AT3G52720 271 / 8e-91 A. THALIANA ALPHA CARBONIC ANHYDRASE 1, alpha carbonic anhydrase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00194 [flax] [poplar] Carb_anhydrase Eukaryotic-type carbonic anhydrase
Representative CDS sequence Show only first row Show all	>Lus10021456 pacid=23179163 polypeptide=Lus10021456 locus=Lus10021456.g ID=Lus10021456.BGIv1.0 annot-version=v1.0 ATGAACGATAGGGTCGATGTTGTTTCACATTTGGGGAGGCTCAATAGAAGCTACAACGCAGCTAATGCCACTCTTAAGAATAGAGGCCACGACATGATGC TGAAATGGGAAGGCGGGGCAGGAAGCTTCCATATGAATGGAACTGAGTACACCCTCCATCAATGCCATTGGCACTCTCCTTCTGAGCACACCATCAATGG CAAAAAATTTGCCATGGAGGCTCACATGGTACATGAAAGTGAAGATGGGAAGATTGCTGTGGTGGGAATCCTTTACAAAATCGGTAGACCCGACTCGTTT CTTAAATCGATAAGTGATCATTTTGAGGAGATCCAAGGGTTTGAGGAAGAAGAGTCTATGGTAGGAGAGATGGATCCTAGAGACATAAGGATTGGTAGTA GAAAGTACTATAGATACATTGGATCTCTCACTGTTCCTCCTTGTACTGAAAATGTGACATGGACTATTGTTAGAAAGGTCAGGACCGTGTCGAGAGAGCA ACTAAGATTGCTTCGAGTGGCTGTTCACGATGATGCGAACACGAATGCTAGACCGTTGCAGCCGAAATTCGGAAGGAAAGTGGAGATGTTCAGACCGAAC GAGGAGAGTAGCGACGATGATGGAATCGACGATTAA
AA sequence Show only first row Show all	>Lus10021456 pacid=23179163 polypeptide=Lus10021456 locus=Lus10021456.g ID=Lus10021456.BGIv1.0 annot-version=v1.0 MNDRVDVVSHLGRLNRSYNAANATLKNRGHDMMLKWEGGAGSFHMNGTEYTLHQCHWHSPSEHTINGKKFAMEAHMVHESEDGKIAVVGILYKIGRPDSF LKSISDHFEEIQGFEEEESMVGEMDPRDIRIGSRKYYRYIGSLTVPPCTENVTWTIVRKVRTVSREQLRLLRVAVHDDANTNARPLQPKFGRKVEMFRPN EESSDDDGIDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08080		ATACA7, ACA7	A. THALIANA ALPHA CARBONIC ANH...		Lus10021456 [exp]	0	1
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10008919 [exp]	2.2	0.9956
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10042512 [exp]	3.0	0.9554
AT5G09360		LAC14	laccase 14 (.1)		Lus10036070 [exp]	3.2	0.9956
AT2G26490			Transducin/WD40 repeat-like su...		Lus10016289 [exp]	3.9	0.9956
AT3G18080		BGLU44	B-S glucosidase 44 (.1)		Lus10017997 [exp]	4.5	0.9956
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10008372 [exp]	5.0	0.9956
AT1G55790			Domain of unknown function (DU...		Lus10032900 [exp]	6.0	0.9800
					Lus10014629 [exp]	6.5	0.9661
					Lus10032804 [exp]	6.9	0.9628
AT5G27470			seryl-tRNA synthetase / serine...		Lus10010212 [exp]	6.9	0.7256

Compare expression of checked genes

Lus10021456 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.