Lus10021477 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G28430 100 / 2e-29 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022580 167 / 4e-56 AT2G28430 100 / 2e-29 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G210800 93 / 1e-26 AT2G28430 70 / 2e-17 unknown protein
Potri.009G013701 47 / 6e-09 ND /
PFAM info
Representative CDS sequence
>Lus10021477 pacid=23179175 polypeptide=Lus10021477 locus=Lus10021477.g ID=Lus10021477.BGIv1.0 annot-version=v1.0
ATGCTCAGCATTCTCGCTCAGGAGCGCGTGCTCGGATTCGCATTGGGTGGCTCCTTTACTGGTTTCGTGGTGTTCGAGCAGCGGAGGCGCATCCGTCAGT
CCGTCTCTGCTTACCAATCTCCGTCGGATGCAAATAATCAGTTGAAAGACCCGATATTCGGGAAGCAATTTCGTTCGGAGTTTGCTCTTATGTGGAACAA
AGCTGTGGACCAGGCTTTCGGGCCACTGGTTTCTTCCCTTAGTTCACACAGAGATTAA
AA sequence
>Lus10021477 pacid=23179175 polypeptide=Lus10021477 locus=Lus10021477.g ID=Lus10021477.BGIv1.0 annot-version=v1.0
MLSILAQERVLGFALGGSFTGFVVFEQRRRIRQSVSAYQSPSDANNQLKDPIFGKQFRSEFALMWNKAVDQAFGPLVSSLSSHRD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G28430 unknown protein Lus10021477 0 1
AT4G17960 unknown protein Lus10000314 3.7 0.9366
AT5G03030 Chaperone DnaJ-domain superfam... Lus10023494 4.9 0.9292
AT5G20090 Uncharacterised protein family... Lus10038250 5.5 0.9357
AT1G48160 signal recognition particle 19... Lus10011152 5.7 0.9182
AT1G36310 S-adenosyl-L-methionine-depend... Lus10040430 6.5 0.9215
AT2G25950 Protein of unknown function (D... Lus10007454 7.1 0.9345
AT5G03455 ACR2, ARATH;CDC... ARSENATE REDUCTASE 2, Rhodanes... Lus10021515 9.5 0.9284
AT1G01210 DNA-directed RNA polymerase, s... Lus10005984 13.8 0.8726
AT4G33690 unknown protein Lus10040497 24.0 0.9081
AT4G22310 Uncharacterised protein family... Lus10023745 24.9 0.9234

Lus10021477 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.