Lus10021479 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022582 75 / 2e-17 AT3G45230 67 / 2e-14 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021479 pacid=23179156 polypeptide=Lus10021479 locus=Lus10021479.g ID=Lus10021479.BGIv1.0 annot-version=v1.0
ATGTCGGCCAAGTGTTCGATGCTAGTCTTCCTACTTCTCCCCTTCCTTTCACTCGCCCAGTCACCGAGTCTGTCTCCCGGATCATCACCATCTCCGTCGC
CGGATTATGGATCACCGGCCTATTCGCCGTCGCCTATGTTCGATTCACCGCCAGAGGCTACTCCTTCTGATCTGATGAGAAATAGTCCTTCCTCTGCTCC
AGCTCCAGCTCCAGCTCCGGCCAAATTAGCTCATGTGCCTGCTCCGAGCAAGAGCGAGTATGCGGCGGACATCGACGGTGAGGTGGTGAAGAGCGATGAC
TCGACGGGGACGGGCGGCGGGAAGAAGGCTGGAATCGCTGTCGGGCTGGTGGCGGCGGTTTGCCTGGTGGGATTCGGTGGGATGATTTACCGGAAGAGGC
AGGAGAATATCAGGAGGGCGCGTTACAGATACGTCGCCGAGACGGAACTGCTCGGAAGAAATACCGGACCTTACCCTTAA
AA sequence
>Lus10021479 pacid=23179156 polypeptide=Lus10021479 locus=Lus10021479.g ID=Lus10021479.BGIv1.0 annot-version=v1.0
MSAKCSMLVFLLLPFLSLAQSPSLSPGSSPSPSPDYGSPAYSPSPMFDSPPEATPSDLMRNSPSSAPAPAPAPAKLAHVPAPSKSEYAADIDGEVVKSDD
STGTGGGKKAGIAVGLVAAVCLVGFGGMIYRKRQENIRRARYRYVAETELLGRNTGPYP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45230 hydroxyproline-rich glycoprote... Lus10021479 0 1
AT3G45230 hydroxyproline-rich glycoprote... Lus10022582 2.2 0.9215
AT5G03170 ATFLA11, FLA11,... ARABIDOPSIS FASCICLIN-LIKE ARA... Lus10036114 4.2 0.9017
AT5G62230 ERL1 ERECTA-like 1 (.1.2) Lus10027580 6.6 0.8906
AT5G10770 Eukaryotic aspartyl protease f... Lus10000265 6.7 0.8875
AT5G62350 Plant invertase/pectin methyle... Lus10031713 6.9 0.8506
Lus10041664 7.7 0.8860
AT5G10770 Eukaryotic aspartyl protease f... Lus10020099 7.9 0.8932
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10022522 8.8 0.8360
AT5G60490 FLA12 FASCICLIN-like arabinogalactan... Lus10002985 8.9 0.8809
AT1G64380 AP2_ERF Integrase-type DNA-binding sup... Lus10001898 9.2 0.8614

Lus10021479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.