Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37770 443 / 2e-158 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37790 412 / 5e-146 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT3G53880 402 / 6e-142 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37760 374 / 3e-131 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT5G01670 245 / 3e-80 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT5G62420 224 / 4e-72 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 214 / 3e-68 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 213 / 7e-68 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 189 / 3e-58 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 178 / 6e-54 NAD(P)-linked oxidoreductase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010885 [exp] 473 / 1e-169 AT2G37770 502 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024353 [exp] 433 / 5e-154 AT2G37770 491 / 1e-176 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10012652 [exp] 418 / 1e-146 AT2G37770 441 / 4e-155 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024354 [exp] 414 / 3e-143 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10010884 [exp] 405 / 5e-143 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10024350 [exp] 313 / 4e-104 AT3G53900 374 / 9e-128 PYRIMIDINE R, uracil phosphoribosyltransferase (.1.2) Lus10031162 [exp] 233 / 2e-75 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029208 [exp] 229 / 1e-73 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10027216 [exp] 229 / 1e-73 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G090600 [exp] 426 / 3e-151 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 414 / 8e-147 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102032 [exp] 407 / 1e-143 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 375 / 2e-131 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 352 / 5e-122 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.008G144600 [exp] 236 / 5e-76 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 233 / 7e-75 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 226 / 8e-73 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 226 / 2e-72 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 223 / 3e-71 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10021491 pacid=23179184 polypeptide=Lus10021491 locus=Lus10021491.g ID=Lus10021491.BGIv1.0 annot-version=v1.0 ATGGGAAACGGCGTCCCATTCTTCGAATTGAACACCGGAGCTAAGATTCCGTCGGTAGGGCTCGGAACTTGGCAGGCTGAACCTGGCGTCGTCGGAGCTG CCGTCGAGGCTGCTATCAAGATTGGTTACCGGCATATCGATTGTGCTAGAGCTTATAACAACGAAAAGGAGATCGGTGCTGTTCTGAAGAAGCTCTTTGA AGAGGGCGTGGTGAAGCGTGAAGATTTGTTTATTACTTCAAAGCTCTGGTGCAATGCTCATGATCCAGAAGATGTTCCAGAAGCACTGGAGAAGACTTTA ACAGAGCTACAGCTTGAGTATATTGATCTCTATCTTATTCATTGGCCTATTCGAATGAAGAGAGGGGCATTCGTTGAACCAGACATTCCAAGCACATGGA AAGCAATGGAAGCACTTTATGATTCAGGCAAGACTCGTGCTATTGGTGTCAGTAACTTCACTGTTAAGAAACTGGGAGATCTGTTGGAGCTGGCTCGTGT ACCCCCTGCTGTCAATCAGGTAGAATGTCATCCAGCATGGCAGCAGCCCAAATTACATGCCTTCTGTCAGTCCAAAGGCGTCCACCTATCAGGTTATTCT CCACTGGGATCTCCTGGAACCACTTGGATGAAGGGTGATGTCCTCAACAATCCGATCCTTGCTATGGTTGCGCAGAAACTAGACAAAACTCCAGCACAGG TGGCGTTGCGTTGGGGTCTGCAGATGGGTCACAGTGTGCTCCCAAAGAGTACACGTGATACAAGGATCAAGGAGAACATTCAAGTCCAGGGCTGGTCTAT CCCTGACAACTTATTCGCTAAATTTTCCGAAATCGAACAGGCAAGTCCCTCTCATTCGTGTTTTTCTAGTTAG
AA sequence Show only first row Show all	>Lus10021491 pacid=23179184 polypeptide=Lus10021491 locus=Lus10021491.g ID=Lus10021491.BGIv1.0 annot-version=v1.0 MGNGVPFFELNTGAKIPSVGLGTWQAEPGVVGAAVEAAIKIGYRHIDCARAYNNEKEIGAVLKKLFEEGVVKREDLFITSKLWCNAHDPEDVPEALEKTL TELQLEYIDLYLIHWPIRMKRGAFVEPDIPSTWKAMEALYDSGKTRAIGVSNFTVKKLGDLLELARVPPAVNQVECHPAWQQPKLHAFCQSKGVHLSGYS PLGSPGTTWMKGDVLNNPILAMVAQKLDKTPAQVALRWGLQMGHSVLPKSTRDTRIKENIQVQGWSIPDNLFAKFSEIEQASPSHSCFSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10021491 [exp]	0	1
AT4G27950	AP2_ERF	CRF4	cytokinin response factor 4 (....		Lus10027573 [exp]	13.2	0.7354
AT1G21200	Trihelix		sequence-specific DNA binding ...		Lus10029777 [exp]	44.9	0.6754
AT5G06990			Protein of unknown function, D...		Lus10008672 [exp]	51.1	0.5905
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10035859 [exp]	51.7	0.6699
AT1G49420			Heavy metal transport/detoxifi...		Lus10038786 [exp]	52.6	0.6749
AT5G03160		ATP58IPK	homolog of mamallian P58IPK (....		Lus10026498 [exp]	64.6	0.5987
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10007525 [exp]	73.1	0.6517
AT3G16770	AP2_ERF	RAP2.03, ATEBP,...	RELATED TO AP2 3, ETHYLENE RES...		Lus10016827 [exp]	77.5	0.6557
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10026535 [exp]	80.1	0.6493
AT3G62600		ATERDJ3B	DNAJ heat shock family protein...		Lus10003651 [exp]	81.2	0.6468

Compare expression of checked genes

Lus10021491 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.