Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G03270 117 / 9e-35 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 96 / 4e-26 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 70 / 7e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 69 / 7e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 69 / 2e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G11930 67 / 1e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G68300 66 / 1e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 61 / 4e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT5G54430 54 / 2e-09 ATPHOS32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022602 [exp] 220 / 2e-75 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10017207 [exp] 197 / 5e-66 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 196 / 1e-65 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10016900 [exp] 103 / 1e-26 AT3G17020 229 / 1e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10037761 [exp] 97 / 1e-26 AT3G17020 224 / 4e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 64 / 1e-13 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 59 / 5e-12 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 59 / 6e-12 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10038561 [exp] 59 / 1e-11 AT1G11360 224 / 7e-74 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G092700 [exp] 156 / 4e-50 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.016G104600 [exp] 152 / 2e-48 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.017G144301 [exp] 119 / 3e-35 AT3G03270 248 / 9e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.004G075375 [exp] 118 / 5e-35 AT3G03270 243 / 9e-84 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G144100 [exp] 101 / 2e-28 AT3G17020 234 / 3e-80 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 72 / 7e-17 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 68 / 5e-15 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 65 / 5e-14 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.008G121900 [exp] 62 / 5e-13 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 61 / 3e-12 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10021501 pacid=23179131 polypeptide=Lus10021501 locus=Lus10021501.g ID=Lus10021501.BGIv1.0 annot-version=v1.0 ATGGGAAAAGACAAGACGATCGGCGTAGCCATGGACTTCTCAGCGAGCAGCAAGAACGCTCTGAAATGGGCATTAGACAACTTAGCAGATAAGGGCGACA CCATCTACATCATCCATGTCAATCCCCATGAGCTCCCCGAAGGCAAAAATCAACTCGGGGGCACCGCCGGCTCTCTGACGAAGCTGTACTGGGGAGGAGA CGCTAGGGAGAGGATCATTGACGCCATTGAAGGGTTGAAGCTTGACTCTGTTGTGATGGGAAGCAGAGGACTCGGCACTGTTAAGAGGATATTGATGGGA AGTGTGAGTTCGTATGTGATGAACGCGGCTTCTTGCCCTGTCACCATTGTCAAGGAAGCATAA
AA sequence Show only first row Show all	>Lus10021501 pacid=23179131 polypeptide=Lus10021501 locus=Lus10021501.g ID=Lus10021501.BGIv1.0 annot-version=v1.0 MGKDKTIGVAMDFSASSKNALKWALDNLADKGDTIYIIHVNPHELPEGKNQLGGTAGSLTKLYWGGDARERIIDAIEGLKLDSVVMGSRGLGTVKRILMG SVSSYVMNAASCPVTIVKEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53990			Adenine nucleotide alpha hydro...		Lus10021501 [exp]	0	1
AT4G12240	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10024570 [exp]	4.4	0.9121
AT5G66040		STR16	sulfurtransferase protein 16 (...		Lus10021227 [exp]	5.7	0.9217
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10036537 [exp]	7.5	0.9352
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10032745 [exp]	9.4	0.9362
AT5G19970			unknown protein		Lus10019451 [exp]	11.3	0.9241
AT3G21510		ATHP3, AHP1	histidine-containing phosphotr...		Lus10012777 [exp]	12.0	0.9086
AT2G45630			D-isomer specific 2-hydroxyaci...		Lus10036536 [exp]	12.4	0.9324
AT2G44420			protein N-terminal asparagine ...		Lus10033495 [exp]	16.1	0.9287
AT3G11040		AtENGase85B	Endo-beta-N-acetyglucosaminida...		Lus10007526 [exp]	17.0	0.9040
AT2G31800			Integrin-linked protein kinase...		Lus10027107 [exp]	18.2	0.9095

Compare expression of checked genes

Lus10021501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.