Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59860 69 / 4e-16 HSP20-like chaperones superfamily protein (.1) AT1G07400 69 / 4e-16 HSP20-like chaperones superfamily protein (.1) AT2G29500 68 / 9e-16 HSP20-like chaperones superfamily protein (.1) AT1G53540 68 / 1e-15 HSP20-like chaperones superfamily protein (.1) AT3G46230 65 / 2e-14 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1) AT5G59720 62 / 2e-13 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1) AT4G10250 50 / 1e-08 ATHSP22.0 HSP20-like chaperones superfamily protein (.1) AT5G37670 44 / 1e-06 HSP15.7CI HSP20-like chaperones superfamily protein (.1) AT4G21870 41 / 2e-05 HSP20-like chaperones superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022604 [exp] 177 / 3e-59 AT1G07400 88 / 2e-23 HSP20-like chaperones superfamily protein (.1) Lus10021109 [exp] 71 / 2e-16 AT1G07400 95 / 6e-25 HSP20-like chaperones superfamily protein (.1) Lus10017202 [exp] 71 / 3e-16 AT1G53540 96 / 2e-25 HSP20-like chaperones superfamily protein (.1) Lus10016458 [exp] 67 / 3e-15 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1) Lus10040723 [exp] 67 / 3e-15 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1) Lus10016457 [exp] 67 / 3e-15 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1) Lus10016456 [exp] 67 / 3e-15 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1) Lus10040722 [exp] 67 / 5e-15 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1) Lus10009085 [exp] 66 / 8e-15 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G049900 [exp] 73 / 1e-17 AT2G29500 154 / 2e-48 HSP20-like chaperones superfamily protein (.1) Potri.009G049800 [exp] 70 / 3e-16 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1) Potri.004G187400 [exp] 69 / 5e-16 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1) Potri.019G081250 [exp] 69 / 5e-16 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1) Potri.008G062300 [exp] 69 / 5e-16 AT5G59720 198 / 9e-66 heat shock protein 18.2 (.1) Potri.008G062350 [exp] 69 / 6e-16 AT5G59720 196 / 3e-65 heat shock protein 18.2 (.1) Potri.010G195700 [exp] 69 / 6e-16 AT5G59720 190 / 1e-62 heat shock protein 18.2 (.1) Potri.004G187450 [exp] 69 / 7e-16 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1) Potri.009G148000 [exp] 69 / 9e-16 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1) Potri.009G039200 [exp] 68 / 1e-15 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [flax] [poplar] HSP20 PF00011 [flax] [poplar] HSP20 Hsp20/alpha crystallin family
Representative CDS sequence Show only first row Show all	>Lus10021503 pacid=23179197 polypeptide=Lus10021503 locus=Lus10021503.g ID=Lus10021503.BGIv1.0 annot-version=v1.0 ATGGATTGGCAGGAGTCCGCAGATGCACACGTGTTGAGAGCCCAGCTGTCGGGATTCAAGGAGGAGGAAGTGATGCTACAACTGGAAGAAGAAGGAGCGG GTGACGTGATTCGCATCAGCTGCGAGAAGGTGGTGGAGATCAAGGAAGAGATGGAGAATGGATGGTACCATGTTGGGCGTAGCAGCGGGCTGAATCATCA GCGTGTGAGGCTGCCGGAGTCTGCTGATCCCAAGCATATGGAAGCTGGGATGGAGGATGGGGTGCTTACGGTTACTATTCGGAAGAAGAGTTCAGGATTC GTCGATGTTTCTTAA
AA sequence Show only first row Show all	>Lus10021503 pacid=23179197 polypeptide=Lus10021503 locus=Lus10021503.g ID=Lus10021503.BGIv1.0 annot-version=v1.0 MDWQESADAHVLRAQLSGFKEEEVMLQLEEEGAGDVIRISCEKVVEIKEEMENGWYHVGRSSGLNHQRVRLPESADPKHMEAGMEDGVLTVTIRKKSSGF VDVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07400			HSP20-like chaperones superfam...		Lus10021503 [exp]	0	1
					Lus10025868 [exp]	4.1	0.9414
AT5G28010			Polyketide cyclase/dehydrase a...		Lus10002175 [exp]	6.0	0.9175
AT2G36650			unknown protein		Lus10014389 [exp]	6.0	0.9366
					Lus10032860 [exp]	6.2	0.9411
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10009445 [exp]	6.3	0.9360
AT4G05430			Carbohydrate-binding X8 domain...		Lus10023276 [exp]	6.5	0.9338
AT1G71100		RSW10	RADIAL SWELLING 10, Ribose 5-p...		Lus10026777 [exp]	6.8	0.8798
AT4G05430			Carbohydrate-binding X8 domain...		Lus10038529 [exp]	8.4	0.9222
AT1G66920			Protein kinase superfamily pro...		Lus10025547 [exp]	8.7	0.8997
					Lus10010378 [exp]	8.9	0.9351

Compare expression of checked genes

Lus10021503 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.