Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G39210 155 / 8e-46 Major facilitator superfamily protein (.1) AT2G28120 146 / 2e-42 Major facilitator superfamily protein (.1) AT1G18940 95 / 6e-24 Nodulin-like / Major Facilitator Superfamily protein (.1) AT1G74780 94 / 1e-23 Nodulin-like / Major Facilitator Superfamily protein (.1) AT3G01930 87 / 6e-21 Major facilitator superfamily protein (.1.2) AT2G34355 85 / 3e-20 Major facilitator superfamily protein (.1) AT5G14120 84 / 6e-20 Major facilitator superfamily protein (.1) AT5G50630 82 / 3e-19 Major facilitator superfamily protein (.1) AT5G50520 82 / 3e-19 Major facilitator superfamily protein (.1) AT2G34350 81 / 5e-19 Nodulin-like / Major Facilitator Superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014640 [exp] 156 / 4e-46 AT2G39210 728 / 0.0 Major facilitator superfamily protein (.1) Lus10033790 [exp] 152 / 2e-44 AT2G39210 734 / 0.0 Major facilitator superfamily protein (.1) Lus10021513 [exp] 143 / 2e-41 AT2G39210 587 / 0.0 Major facilitator superfamily protein (.1) Lus10037948 [exp] 140 / 3e-40 AT2G39210 839 / 0.0 Major facilitator superfamily protein (.1) Lus10038682 [exp] 140 / 6e-40 AT2G39210 829 / 0.0 Major facilitator superfamily protein (.1) Lus10037949 [exp] 139 / 1e-39 AT2G39210 807 / 0.0 Major facilitator superfamily protein (.1) Lus10022614 [exp] 139 / 2e-39 AT2G39210 652 / 0.0 Major facilitator superfamily protein (.1) Lus10022613 [exp] 128 / 8e-39 AT2G39210 163 / 1e-47 Major facilitator superfamily protein (.1) Lus10042170 [exp] 99 / 4e-25 AT1G74780 566 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G215600 [exp] 148 / 4e-43 AT2G28120 810 / 0.0 Major facilitator superfamily protein (.1) Potri.009G006400 [exp] 147 / 5e-43 AT2G28120 845 / 0.0 Major facilitator superfamily protein (.1) Potri.006G122400 [exp] 147 / 1e-42 AT2G39210 767 / 0.0 Major facilitator superfamily protein (.1) Potri.008G032901 [exp] 147 / 2e-42 AT2G39210 830 / 0.0 Major facilitator superfamily protein (.1) Potri.002G133900 [exp] 138 / 2e-39 AT2G39210 666 / 0.0 Major facilitator superfamily protein (.1) Potri.001G194500 [exp] 126 / 1e-37 AT2G28120 377 / 9e-130 Major facilitator superfamily protein (.1) Potri.015G067000 [exp] 88 / 3e-21 AT1G74780 562 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1) Potri.012G098900 [exp] 84 / 4e-20 AT5G14120 681 / 0.0 Major facilitator superfamily protein (.1) Potri.017G064201 [exp] 84 / 6e-20 AT3G01930 805 / 0.0 Major facilitator superfamily protein (.1.2) Potri.001G329100 [exp] 82 / 3e-19 AT3G01930 869 / 0.0 Major facilitator superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [flax] [poplar] MFS PF06813 [flax] [poplar] Nodulin-like Nodulin-like
Representative CDS sequence Show only first row Show all	>Lus10021512 pacid=23179213 polypeptide=Lus10021512 locus=Lus10021512.g ID=Lus10021512.BGIv1.0 annot-version=v1.0 ATGCCCGTCGAAGCGTCCAAAGTCGGATGTTTACGGACGAAGAGTTTCCTCCGCCAGGTCATCATCGGGCGGTGGTTCATGTTCTTCGCAGCTTTGTTGA TCGAGGCTGGGTCGGGTGCCTCGTACATGTTCGGGATATATTCCCGCGACATCAAATCCTCGTTAGGGTACGACCAATCCACGCTCAACCTCCTCGGGTT CTTCAAAGACCTCGGCGGCAACCTCGGCGTCCTGGCAGGGTTAATGAACGAGGTGTTGCCGTCGTGGGTTATACTGTTGATGGGCGCTATCATGGACTTC GGTGGGTACTTCATGATCTGGCTCGCCGTTGTCCGGAAGATAGCTAAGCCTCCCGTGTAG
AA sequence Show only first row Show all	>Lus10021512 pacid=23179213 polypeptide=Lus10021512 locus=Lus10021512.g ID=Lus10021512.BGIv1.0 annot-version=v1.0 MPVEASKVGCLRTKSFLRQVIIGRWFMFFAALLIEAGSGASYMFGIYSRDIKSSLGYDQSTLNLLGFFKDLGGNLGVLAGLMNEVLPSWVILLMGAIMDF GGYFMIWLAVVRKIAKPPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G39210			Major facilitator superfamily ...		Lus10021512 [exp]	0	1
AT4G37370		CYP81D8	"cytochrome P450, family 81, s...		Lus10010373 [exp]	1.0	0.9938
AT5G63160		BT1	BTB and TAZ domain protein 1 (...		Lus10033038 [exp]	1.4	0.9835
AT5G26594		ARR24	response regulator 24 (.1)		Lus10005407 [exp]	2.0	0.9580
					Lus10017557 [exp]	2.2	0.9566
AT3G50940			P-loop containing nucleoside t...		Lus10015802 [exp]	3.0	0.9450
AT3G48360		ATBT2, BT2	BTB and TAZ domain protein 2 (...		Lus10013670 [exp]	3.7	0.9520
					Lus10027664 [exp]	4.0	0.9480
					Lus10036703 [exp]	4.2	0.9541
AT1G56220			Dormancy/auxin associated fami...		Lus10020661 [exp]	4.9	0.9355
AT3G13750		BGAL1	beta-galactosidase 1, beta gal...		Lus10037644 [exp]	6.2	0.8996

Compare expression of checked genes

Lus10021512 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.