Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54940 169 / 6e-56 Translation initiation factor SUI1 family protein (.1.2) AT4G27130 161 / 1e-52 Translation initiation factor SUI1 family protein (.1) AT5G54760 160 / 1e-52 Translation initiation factor SUI1 family protein (.1.2.3) AT1G54290 158 / 1e-51 Translation initiation factor SUI1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039660 [exp] 159 / 4e-52 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10027181 [exp] 159 / 4e-52 AT4G27130 216 / 1e-74 Translation initiation factor SUI1 family protein (.1) Lus10015124 [exp] 152 / 3e-49 AT4G27130 209 / 8e-72 Translation initiation factor SUI1 family protein (.1) Lus10031550 [exp] 152 / 8e-49 AT4G27130 207 / 2e-70 Translation initiation factor SUI1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G151700 [exp] 183 / 1e-61 AT5G54940 170 / 2e-56 Translation initiation factor SUI1 family protein (.1.2) Potri.001G418600 [exp] 156 / 9e-51 AT1G54290 218 / 2e-75 Translation initiation factor SUI1 family protein (.1) Potri.007G122600 [exp] 155 / 2e-50 AT4G27130 215 / 3e-74 Translation initiation factor SUI1 family protein (.1) Potri.007G122700 [exp] 155 / 2e-50 AT4G27130 217 / 5e-75 Translation initiation factor SUI1 family protein (.1) Potri.011G134700 [exp] 154 / 3e-50 AT4G27130 213 / 3e-73 Translation initiation factor SUI1 family protein (.1) Potri.017G037100 [exp] 139 / 4e-44 AT1G54290 187 / 2e-63 Translation initiation factor SUI1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01253 [flax] [poplar] SUI1 Translation initiation factor SUI1
Representative CDS sequence Show only first row Show all	>Lus10021532 pacid=23159115 polypeptide=Lus10021532 locus=Lus10021532.g ID=Lus10021532.BGIv1.0 annot-version=v1.0 ATGGTTGAACTAGACTTCGAGATCCCATCAGCAATAGACCCATTCGCTGAAGCCAAAAGATCGGGAGCGAAAGAGTATGTGCACATCAGGATACAACAAA GGAATGGAAAGAAGTGCCTGACGACTGTACAAGGGTTGTCAAAGGACTTGAGCTACGAGAAGATCCTGAAAGAGGTGAAGAAAGAGTTCTGCTGCAACGG GAACGTAGTGAATGACAAGGAGCTTGGCAAGGTAGTTCAGCTTCAAGGTGATCAGCGTAAGAACGTTCAGGGCTTCTTGCTCAGGTCCAACCTTGTCAGC AAGGACCAGATCAAGATTCATGGTTTCTGA
AA sequence Show only first row Show all	>Lus10021532 pacid=23159115 polypeptide=Lus10021532 locus=Lus10021532.g ID=Lus10021532.BGIv1.0 annot-version=v1.0 MVELDFEIPSAIDPFAEAKRSGAKEYVHIRIQQRNGKKCLTTVQGLSKDLSYEKILKEVKKEFCCNGNVVNDKELGKVVQLQGDQRKNVQGFLLRSNLVS KDQIKIHGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G54940			Translation initiation factor ...		Lus10021532 [exp]	0	1
AT4G27130			Translation initiation factor ...		Lus10015124 [exp]	6.9	0.9164
AT5G06130			chaperone protein dnaJ-related...		Lus10014223 [exp]	6.9	0.8869
AT1G13740		AFP2	ABI five binding protein 2 (.1...		Lus10037084 [exp]	7.5	0.9043
AT3G23240	AP2_ERF	ERF1, ATERF1	ethylene response factor 1 (.1...		Lus10013959 [exp]	8.0	0.8827
AT4G27780		ACBP2	acyl-CoA binding protein 2 (.1...		Lus10022382 [exp]	9.8	0.9117
AT1G10150		ATPP2-A10	Carbohydrate-binding protein (...		Lus10007727 [exp]	10.2	0.9229
AT1G67910			unknown protein		Lus10034901 [exp]	10.2	0.8915
AT1G48300			unknown protein		Lus10038034 [exp]	11.1	0.9208
AT3G14830			unknown protein		Lus10005552 [exp]	11.4	0.9045
AT5G46180		DELTA-OAT	ornithine-delta-aminotransfera...		Lus10023299 [exp]	17.3	0.9072

Compare expression of checked genes

Lus10021532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.