Plant FIBer expression Database

Lus10021534 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G42990 72 / 2e-15 bZIP AtBZIP60 Bbasic region/leucine zipper motif 60, basic region/leucine zipper motif 60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040069
[exp]
221 / 1e-72 AT1G42990 84 / 4e-18 Bbasic region/leucine zipper motif 60, basic region/leucine zipper motif 60 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G257900
[exp]
99 / 9e-26 AT1G42990 101 / 1e-24 Bbasic region/leucine zipper motif 60, basic region/leucine zipper motif 60 (.1)
PFAM info
Representative CDS sequence
>Lus10021534 pacid=23159093 polypeptide=Lus10021534 locus=Lus10021534.g ID=Lus10021534.BGIv1.0 annot-version=v1.0
ATGTATGTGAAGGATCTGGAGATGAAGAGCAAGTATTTGGAATGGGAATGTAGGAGACTGGGGCGGTTGCTTCAGTGCTGCGTTGCTGAGAATCAAGCTC
TGCGGTTTAGTTTGCAGAGTGGAAGTGGTATTGCGGCATATGGTGCTACCTCGGCCAGGCAGGAGTCTGCTGTGCTCTTGTTGGAATCCCTGCTGTTGGG
TTCCCTGCTTTGGTTCCTGGGCATCATGTGCCTGTTCAGTCTAGCGACTGTGACCCAGTTAATGGTTCCTCTACTGGAACCAAAAGGGGAGAGTGGAAAA
GAAGGAAAAAGAAGTAAAATGGCAACGCCGCATCTGGGCCAGCCATTTCTGGTAAGGGGCAGGAGATGCAAGGCTTCACGTACTAGGATGAAACTGACAT
ATTTATATTCATCATGCATAGGTGTTATGGTGGAAGAGAGTAGGGCTATGTGCTGTTTAGTGAAGTAA
AA sequence
>Lus10021534 pacid=23159093 polypeptide=Lus10021534 locus=Lus10021534.g ID=Lus10021534.BGIv1.0 annot-version=v1.0
MYVKDLEMKSKYLEWECRRLGRLLQCCVAENQALRFSLQSGSGIAAYGATSARQESAVLLLESLLLGSLLWFLGIMCLFSLATVTQLMVPLLEPKGESGK
EGKRSKMATPHLGQPFLVRGRRCKASRTRMKLTYLYSSCIGVMVEESRAMCCLVK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G42990 bZIP AtBZIP60 Bbasic region/leucine zipper m... Lus10021534
[exp]
0 1
AT1G77480 Eukaryotic aspartyl protease f... Lus10025687
[exp]
2.0 0.8954
AT4G26190 Haloacid dehalogenase-like hyd... Lus10032890
[exp]
3.9 0.8473
AT2G41835 C2H2ZnF zinc finger (C2H2 type, AN1-li... Lus10012196
[exp]
5.7 0.8527
AT1G01550 BPS1 BYPASS 1, Protein of unknown f... Lus10005326
[exp]
6.5 0.8318
AT5G10695 unknown protein Lus10026229
[exp]
7.6 0.7741
AT4G35600 Kin4, CX32, CST... kinase 4, CONNEXIN 32, CAST AW... Lus10024512
[exp]
9.4 0.8286
AT5G47530 Auxin-responsive family protei... Lus10006398
[exp]
10.0 0.8400
AT4G33780 unknown protein Lus10035665
[exp]
11.4 0.8379
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10020735
[exp]
12.7 0.8246
AT2G41410 Calcium-binding EF-hand family... Lus10027261
[exp]
15.2 0.8070

Lus10021534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.