Lus10021542 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55050 116 / 4e-32 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G37690 100 / 4e-26 SGNH hydrolase-type esterase superfamily protein (.1)
AT3G14820 94 / 9e-24 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT4G16230 89 / 1e-22 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT2G23540 91 / 2e-22 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G18430 91 / 2e-22 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT3G50400 91 / 2e-22 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G42170 89 / 7e-22 SGNH hydrolase-type esterase superfamily protein (.1)
AT3G04290 89 / 8e-22 ATLTL1, LTL1 Li-tolerant lipase 1 (.1)
AT4G28780 87 / 2e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021540 149 / 2e-44 AT5G55050 357 / 5e-122 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10040065 101 / 5e-29 AT5G55050 99 / 4e-26 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10025105 102 / 5e-27 AT5G55050 233 / 2e-73 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10039877 102 / 7e-27 AT5G37690 527 / 0.0 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10028423 101 / 2e-26 AT3G14820 317 / 7e-107 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10023979 101 / 2e-26 AT5G55050 229 / 5e-72 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10028424 100 / 2e-26 AT3G14820 298 / 2e-99 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10018641 100 / 5e-26 AT5G37690 516 / 0.0 SGNH hydrolase-type esterase superfamily protein (.1)
Lus10023980 100 / 5e-26 AT5G55050 215 / 1e-66 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G089700 146 / 7e-44 AT5G55050 375 / 3e-129 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.017G130100 99 / 1e-25 AT5G37690 526 / 0.0 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.019G067600 95 / 4e-24 AT1G71250 473 / 9e-168 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.002G253400 95 / 6e-24 AT4G28780 558 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.004G086700 93 / 2e-23 AT5G37690 527 / 0.0 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.019G024700 91 / 1e-22 AT5G33370 549 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
Potri.008G104600 89 / 5e-22 AT2G23540 370 / 3e-127 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.019G024600 89 / 1e-21 AT5G33370 568 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
Potri.011G076500 88 / 2e-21 AT5G45670 533 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.019G024800 87 / 4e-21 AT5G33370 544 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10021542 pacid=23159085 polypeptide=Lus10021542 locus=Lus10021542.g ID=Lus10021542.BGIv1.0 annot-version=v1.0
ATGACAACGACGACGTCGGTGGAGGCTCAGAGTCAGACGGTACCGGCGATGTTCGTATTTGGCGACTCATTAGTTGATGTTGGGAACAACAACTATCTTC
CGGTGTCGTTTAGCAAAGCAAATTTCCCACATAATGGGATTGATTTTCCCGCCAAGATGCCAACTGGAAGATTCTCTAATGGCAAAAATTCTGCCGACTG
GCTTGCTGAGAAGTTGGGGGTGGCAAGTTGCCCACCTTATTTATCAGTGGACAGGAAGAATGGGTCTGCTCTGATTGGCGGCGTCAGCTTCGCATCTGGC
GGTGCCCTACTTCTCAACCGTACAATTGATCAGAATCCGTTCCTCTTACGTCTGGCAATTCGGTTAAAATTGGTTACTTGA
AA sequence
>Lus10021542 pacid=23159085 polypeptide=Lus10021542 locus=Lus10021542.g ID=Lus10021542.BGIv1.0 annot-version=v1.0
MTTTTSVEAQSQTVPAMFVFGDSLVDVGNNNYLPVSFSKANFPHNGIDFPAKMPTGRFSNGKNSADWLAEKLGVASCPPYLSVDRKNGSALIGGVSFASG
GALLLNRTIDQNPFLLRLAIRLKLVT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10021542 0 1
Lus10028027 3.5 0.8848
AT5G06760 AtLEA4-5, LEA4-... Late Embryogenesis Abundant 4-... Lus10016266 4.6 0.7698
Lus10026021 5.2 0.7521
AT5G14400 CYP724A1 "cytochrome P450, family 724, ... Lus10025183 6.3 0.8624
AT2G26850 F-box family protein (.1) Lus10036444 62.9 0.7133
AT5G22470 NAD+ ADP-ribosyltransferases;N... Lus10043383 68.9 0.6704
AT1G21000 PLATZ transcription factor fam... Lus10005350 87.1 0.6749
AT5G52605 Defensin-like (DEFL) family pr... Lus10031095 87.3 0.6749
Lus10035508 87.5 0.6749
AT5G56670 Ribosomal protein S30 family p... Lus10019054 87.7 0.6749

Lus10021542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.