Lus10021553 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25290 152 / 3e-44 Auxin-responsive family protein (.1.2)
AT5G35735 144 / 5e-41 Auxin-responsive family protein (.1)
AT4G12980 142 / 2e-40 Auxin-responsive family protein (.1)
AT4G17280 142 / 4e-40 Auxin-responsive family protein (.1)
AT5G47530 140 / 2e-39 Auxin-responsive family protein (.1)
AT2G04850 117 / 5e-31 Auxin-responsive family protein (.1)
AT3G59070 100 / 2e-24 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT3G07570 99 / 3e-24 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT3G61750 97 / 2e-23 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT5G54830 55 / 1e-08 DOMON domain-containing protein / dopamine beta-monooxygenase N-terminal domain-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000915 206 / 4e-64 AT3G25290 205 / 2e-61 Auxin-responsive family protein (.1.2)
Lus10025877 143 / 3e-41 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10002274 143 / 1e-40 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10017564 143 / 2e-40 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1)
Lus10006398 140 / 2e-40 AT5G47530 276 / 2e-91 Auxin-responsive family protein (.1)
Lus10001734 142 / 3e-40 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1)
Lus10038225 136 / 1e-39 AT3G25290 283 / 6e-95 Auxin-responsive family protein (.1.2)
Lus10012350 140 / 2e-39 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10010498 139 / 5e-39 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G024700 184 / 4e-56 AT5G47530 199 / 7e-60 Auxin-responsive family protein (.1)
Potri.004G006700 146 / 2e-43 AT5G35735 156 / 2e-45 Auxin-responsive family protein (.1)
Potri.006G015000 146 / 1e-41 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1)
Potri.002G249300 145 / 2e-41 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.010G156600 144 / 8e-41 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1)
Potri.010G156200 143 / 9e-41 AT5G47530 472 / 1e-166 Auxin-responsive family protein (.1)
Potri.016G010900 142 / 2e-40 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1)
Potri.014G162000 139 / 4e-39 AT5G47530 369 / 2e-126 Auxin-responsive family protein (.1)
Potri.002G222700 137 / 2e-38 AT5G35735 369 / 8e-126 Auxin-responsive family protein (.1)
Potri.002G222600 125 / 6e-34 AT2G04850 545 / 0.0 Auxin-responsive family protein (.1)
PFAM info
Representative CDS sequence
>Lus10021553 pacid=23159114 polypeptide=Lus10021553 locus=Lus10021553.g ID=Lus10021553.BGIv1.0 annot-version=v1.0
ATGGCGATTGCAAAAGGTCAAACTATAAGTGACGGTGACATGGGTTCTCATGTGCACGGGATAATGAACATAATTGGATGGGGTGTACTGCTACCAGGCG
GGGCGATAATGGTAAGATACCTGAGGTATCCATACCAGGTACAGGAATCCTTCTGGTTTTACGCACACCTCACTTGCCAACTTGCTGGATATAGCCTTGG
CACCGCTGGCTGGATACTTGGGTTGTACCTTGGAAAGGCCTCTACTCGTTATTCCTTCAGAACCCATCGTCTATACTCAATCTTCATCTTCACCTTTGCC
ACTTTACAAGTATTGGCAGTAAAGTTGAGACCAAGATCCACGGACGAGTACAAAAGGTACTGGAACATGTACCACCATTTCTTAGGATATGCGCTGCTAT
CTGTGATCGTCATTAACATATTCCAGGGAATTGGGATTCTGAGACCAGACTATACTTGGAAGTGGACTTACATTAGCATCCTCGTAGCTTTAGCCATAAT
CGTCCTAAGCCTTGAAACTTACACTTGGATCAAATTCTACAGACCTCACCCGCCCAATCATGTCCACCACAACAACAATAACAACCACAGCAACAGTGCG
CGGCCTTCTGGAAATGAGTCCTGCCCAAAATTAGAATATGGTTCGATAGGCCCTTCCCCAAGTTCGACTGCCTCGCCACCAAGTCTGTCGTCCATGTAG
AA sequence
>Lus10021553 pacid=23159114 polypeptide=Lus10021553 locus=Lus10021553.g ID=Lus10021553.BGIv1.0 annot-version=v1.0
MAIAKGQTISDGDMGSHVHGIMNIIGWGVLLPGGAIMVRYLRYPYQVQESFWFYAHLTCQLAGYSLGTAGWILGLYLGKASTRYSFRTHRLYSIFIFTFA
TLQVLAVKLRPRSTDEYKRYWNMYHHFLGYALLSVIVINIFQGIGILRPDYTWKWTYISILVALAIIVLSLETYTWIKFYRPHPPNHVHHNNNNNHSNSA
RPSGNESCPKLEYGSIGPSPSSTASPPSLSSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25290 Auxin-responsive family protei... Lus10021553 0 1
AT1G68430 unknown protein Lus10003042 2.0 0.9418
AT5G65700 BAM1 BARELY ANY MERISTEM 1, Leucine... Lus10035783 2.2 0.9307
AT1G67790 unknown protein Lus10034566 2.2 0.9510
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10016566 2.4 0.9260
AT5G62940 DOF AtDof5.6, HCA2 HIGH CAMBIAL ACTIVITY2, DNA BI... Lus10002381 4.5 0.9155
AT3G18670 Ankyrin repeat family protein ... Lus10027721 4.6 0.9394
AT1G68430 unknown protein Lus10034103 4.6 0.9233
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10005956 5.7 0.9225
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10022305 6.0 0.9369
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10034567 6.0 0.9214

Lus10021553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.