Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06530 134 / 3e-41 VPS2.1 SNF7 family protein (.1) AT1G03950 62 / 3e-13 VPS2.3 vacuolar protein sorting-associated protein 2.3 (.1) AT5G44560 62 / 3e-13 VPS2.2 SNF7 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017166 [exp] 139 / 3e-43 AT2G06530 357 / 2e-126 SNF7 family protein (.1) Lus10037660 [exp] 134 / 2e-41 AT2G06530 358 / 6e-127 SNF7 family protein (.1) Lus10015642 [exp] 134 / 6e-41 AT2G06530 338 / 1e-118 SNF7 family protein (.1) Lus10033914 [exp] 49 / 2e-08 AT1G03950 278 / 5e-96 vacuolar protein sorting-associated protein 2.3 (.1) Lus10038407 [exp] 42 / 1e-05 AT5G44560 323 / 5e-113 SNF7 family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G170400 [exp] 136 / 5e-42 AT2G06530 326 / 2e-114 SNF7 family protein (.1) Potri.018G065100 [exp] 135 / 5e-42 AT2G06530 332 / 9e-117 SNF7 family protein (.1) Potri.005G227000 [exp] 62 / 2e-13 AT1G03950 309 / 3e-108 vacuolar protein sorting-associated protein 2.3 (.1) Potri.002G035900 [exp] 61 / 4e-13 AT1G03950 308 / 8e-108 vacuolar protein sorting-associated protein 2.3 (.1) Potri.001G442500 [exp] 61 / 4e-13 AT5G44560 328 / 3e-115 SNF7 family protein (.1.2) Potri.011G154700 [exp] 61 / 8e-13 AT5G44560 331 / 1e-116 SNF7 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0235 [flax] [poplar] PspA PF03357 [flax] [poplar] Snf7 Snf7
Representative CDS sequence Show only first row Show all	>Lus10021562 pacid=23182099 polypeptide=Lus10021562 locus=Lus10021562.g ID=Lus10021562.BGIv1.0 annot-version=v1.0 ATGATGGACAAATCGATTCGAGAGATTGAGAGGGAAAGGCAAGCTCTACAAACCCAAGAGAAGAAACTTATTGCAGAGATCAAGAAAAATGCCAAGCAAG GCCAAATGGGTGCTGTTAAAATAATGGCTAAGGACCTTATTCGGACAAGACATCAGATTGAAAAATTCTACAAGCTCAAGTCACAGCTCCAAGGTGTATC TCTTAGAATCCAGAGTATTTTGAAATGA
AA sequence Show only first row Show all	>Lus10021562 pacid=23182099 polypeptide=Lus10021562 locus=Lus10021562.g ID=Lus10021562.BGIv1.0 annot-version=v1.0 MMDKSIREIERERQALQTQEKKLIAEIKKNAKQGQMGAVKIMAKDLIRTRHQIEKFYKLKSQLQGVSLRIQSILK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10021562 [exp]	0	1
					Lus10032784 [exp]	6.2	0.6853
AT5G61530			small G protein family protein...		Lus10042986 [exp]	15.1	0.7617
AT5G32450			RNA binding (RRM/RBD/RNP motif...		Lus10013651 [exp]	18.0	0.6914
					Lus10016654 [exp]	24.6	0.6989
AT2G39570		ACR9	ACT domain repeats 9, ACT doma...		Lus10001702 [exp]	27.5	0.5940
AT3G10660		ATCPK2, CPK2	calmodulin-domain protein kina...		Lus10021248 [exp]	28.4	0.6471
AT2G33150		PED1, KAT2, PKT...	PEROXISOME DEFECTIVE 1, 3-KETO...		Lus10011879 [exp]	30.3	0.6942
AT2G11520		CRCK3	calmodulin-binding receptor-li...		Lus10028347 [exp]	34.5	0.7037
AT3G63420		AGG1, ATAGG1	Ggamma-subunit 1 (.1.2)		Lus10029687 [exp]	34.8	0.6639
AT3G10330			Cyclin-like family protein (.1...		Lus10031055 [exp]	39.7	0.6773

Compare expression of checked genes

Lus10021562 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.