Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G49055 55 / 1e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011651 [exp] 72 / 6e-19 AT3G49055 47 / 9e-08 unknown protein Lus10027489 [exp] 76 / 6e-18 AT3G49055 244 / 3e-75 unknown protein Lus10039244 [exp] 40 / 1e-05 AT3G49055 89 / 2e-21 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G146100 [exp] 52 / 9e-10 AT3G49055 191 / 1e-54 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021563 pacid=23182083 polypeptide=Lus10021563 locus=Lus10021563.g ID=Lus10021563.BGIv1.0 annot-version=v1.0 ATGCGATGTATATACAAGAATTGGAAGACTGGGAAAGAGCCTTTAGCTCCGAATGTAGAGGAGCTTACAGCAGAGATCAATGAAGCAGAGGTAGAAGCAG GAAGGTGGATAGATGCTTGCGAGTTAGAAGTGGAAGCTGGGAAGAAAGAGGTTGCAGAACGGGACAAAGTGGTGAACTATAGCTCTTCTTCTTGA
AA sequence Show only first row Show all	>Lus10021563 pacid=23182083 polypeptide=Lus10021563 locus=Lus10021563.g ID=Lus10021563.BGIv1.0 annot-version=v1.0 MRCIYKNWKTGKEPLAPNVEELTAEINEAEVEAGRWIDACELEVEAGKKEVAERDKVVNYSSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G49055			unknown protein		Lus10021563 [exp]	0	1
AT5G24170			Got1/Sft2-like vescicle transp...		Lus10000361 [exp]	6.6	0.6170
AT4G15020			hAT transposon superfamily (.1...		Lus10002709 [exp]	8.9	0.6922
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Lus10012457 [exp]	9.3	0.6889
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10034380 [exp]	17.6	0.6686
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Lus10018411 [exp]	28.6	0.6036
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10028440 [exp]	35.2	0.6463
					Lus10000169 [exp]	37.8	0.6357
					Lus10038619 [exp]	41.0	0.6317
					Lus10040989 [exp]	45.5	0.6046
AT3G04550			unknown protein		Lus10032342 [exp]	49.5	0.5827

Compare expression of checked genes

Lus10021563 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.