Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57040 132 / 8e-41 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017158 [exp] 143 / 4e-45 AT5G57040 254 / 7e-87 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10021573 [exp] 47 / 3e-08 AT5G57040 163 / 2e-51 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G056200 [exp] 126 / 2e-38 AT5G57040 253 / 2e-86 Lactoylglutathione lyase / glyoxalase I family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021574 pacid=23182112 polypeptide=Lus10021574 locus=Lus10021574.g ID=Lus10021574.BGIv1.0 annot-version=v1.0 ATGGAGCTTCCGAATCCAGATCCCTTAACTGGACGCCCTCAACATGGCGGCCGCGATCGCCATGCCTGCCTAGCCATCCGCAATGTCTCCAACCTCAAAA AAATTCTTGACGAAGCTGGACATCCCTATACACTTAGCAAGTCCGGGAGACCTGCCATCTTCACACGAGATCCTGATGCAAATGCGCTCGAGTTTACTCA AGTCGACTGA
AA sequence Show only first row Show all	>Lus10021574 pacid=23182112 polypeptide=Lus10021574 locus=Lus10021574.g ID=Lus10021574.BGIv1.0 annot-version=v1.0 MELPNPDPLTGRPQHGGRDRHACLAIRNVSNLKKILDEAGHPYTLSKSGRPAIFTRDPDANALEFTQVD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G57040			Lactoylglutathione lyase / gly...		Lus10021574 [exp]	0	1
AT2G30100			pentatricopeptide (PPR) repeat...		Lus10042274 [exp]	1.0	0.9363
AT5G57040			Lactoylglutathione lyase / gly...		Lus10021573 [exp]	1.4	0.9353
AT5G57345			unknown protein		Lus10001438 [exp]	5.5	0.9326
AT3G25250		AtOXI1, OXI1, A...	oxidative signal-inducible1, A...		Lus10009592 [exp]	6.6	0.8878
AT1G52190			Major facilitator superfamily ...		Lus10038616 [exp]	6.7	0.9195
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Lus10024303 [exp]	7.7	0.8859
AT4G16380			Heavy metal transport/detoxifi...		Lus10000039 [exp]	7.9	0.8970
AT4G32260		PDE334	PIGMENT DEFECTIVE 334, ATPase,...		Lus10041039 [exp]	10.8	0.9232
AT2G20920			Protein of unknown function (D...		Lus10024004 [exp]	11.2	0.8809
AT1G10500		ATCPISCA	chloroplast-localized ISCA-lik...		Lus10012683 [exp]	12.4	0.8352

Compare expression of checked genes

Lus10021574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.