Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037396 [exp] 143 / 1e-40 AT5G60700 1181 / 0.0 glycosyltransferase family protein 2 (.1) Lus10041317 [exp] 82 / 5e-19 AT5G60700 1204 / 0.0 glycosyltransferase family protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G010900 [exp] 115 / 7e-31 AT5G60700 1170 / 0.0 glycosyltransferase family protein 2 (.1) Potri.004G212000 [exp] 103 / 6e-27 AT5G60700 1167 / 0.0 glycosyltransferase family protein 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021578 pacid=23182097 polypeptide=Lus10021578 locus=Lus10021578.g ID=Lus10021578.BGIv1.0 annot-version=v1.0 ATGGGGATGAGCAGCAGCTTCAAGAGTGGGGATTACTTGGAAGGAATGCTTAGTGATTACGTTGGTGGAGGGAAAGGCAGTAACAACAAGCTCAACAAAT CTGCATCAGCAAGAACAACAAGTGCAACTTCTTCAGCTAAGCTTGTCACAGTCATGACATGCCTCCAATTTGCATTTGCATTCTATGTGACTTTCCTCCT CTACTACATGAGCCCCACAATAGACCTCAGGACCAAACCAAATTTTATTTCCGCCACAAGGTTCACTCAGAACTGGAAGCGCCACTTCGTCATCCCTCCC CATGTCGTTGATCTTGACACAAGAGGTTCTAAGCAGCAATGCTTCGAGCTATGA
AA sequence Show only first row Show all	>Lus10021578 pacid=23182097 polypeptide=Lus10021578 locus=Lus10021578.g ID=Lus10021578.BGIv1.0 annot-version=v1.0 MGMSSSFKSGDYLEGMLSDYVGGGKGSNNKLNKSASARTTSATSSAKLVTVMTCLQFAFAFYVTFLLYYMSPTIDLRTKPNFISATRFTQNWKRHFVIPP HVVDLDTRGSKQQCFEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021578 [exp]	0	1
AT1G19835			Plant protein of unknown funct...		Lus10032386 [exp]	1.4	0.8586
AT1G05160		ATKAO1, CYP88A3	ENT-KAURENOIC ACID OXYDASE 1, ...		Lus10036671 [exp]	6.6	0.8133
AT5G39785			Protein of unknown function (D...		Lus10007264 [exp]	8.9	0.8096
AT3G12620			Protein phosphatase 2C family ...		Lus10023470 [exp]	9.2	0.7912
AT5G38900			Thioredoxin superfamily protei...		Lus10034368 [exp]	13.0	0.8098
AT1G77120		ADH1, ATADH, AT...	ARABIDOPSIS THALIANA ALCOHOL D...		Lus10029757 [exp]	17.3	0.8006
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10027746 [exp]	23.0	0.7677
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	23.4	0.7903
AT5G24310		ABIL3	ABL interactor-like protein 3 ...		Lus10023052 [exp]	23.5	0.6936
AT3G12620			Protein phosphatase 2C family ...		Lus10040346 [exp]	31.8	0.7264

Compare expression of checked genes

Lus10021578 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.