Lus10021579 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023759 157 / 1e-49 ND /
Lus10032702 144 / 3e-43 AT5G56730 135 / 7e-36 Insulinase (Peptidase family M16) protein (.1)
Lus10033166 140 / 2e-41 AT5G39600 207 / 1e-67 unknown protein
Lus10009892 135 / 1e-40 ND 39 / 0.003
Lus10002100 138 / 2e-40 ND /
Lus10033216 130 / 3e-37 AT1G48120 41 / 0.002 hydrolases;protein serine/threonine phosphatases (.1)
Lus10040596 126 / 4e-37 ND /
Lus10025371 128 / 9e-37 ND /
Lus10039500 112 / 2e-29 AT1G08315 383 / 2e-129 ARM repeat superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021579 pacid=23182106 polypeptide=Lus10021579 locus=Lus10021579.g ID=Lus10021579.BGIv1.0 annot-version=v1.0
ATGGGAATGGGGAATGAGTTAGAAGCGCTATCGATAGGAGATGAAGACTTGCCGCGGTTTATCGGTCGTCCTATTTCTGCATCAAATAGGAAATTATTGG
AGGAGAAATTGAAGGGAAAGAAATCTAGGCTAGGGGATGATAGGCAGTCTAGTGTGCAGTTTCAGATTCCTGGTCTGATATACGTGGACCCCGATCTGCA
CTCTATTGGGAGGGAGCTGACTGTTGAGGAGATTTTTGCTACCCAGGCTCCAGATTTTGCTGATGACATCCATGCCATTCAGGATGACTCCGACGGCAAC
GATGAGCAGATCCCGTCGGACGGTGATGGCGATGATGATGAGGATTGTTATGCCTCGTTTCACCCTTTCTTGTTGGATAGTGCACGCTCTCGGAAGAGAG
CACCAGGAGAGGTGCAGATCCTCTTGTGGGTCGCAAGGTTCGTCTACTGTGGGCTCTAG
AA sequence
>Lus10021579 pacid=23182106 polypeptide=Lus10021579 locus=Lus10021579.g ID=Lus10021579.BGIv1.0 annot-version=v1.0
MGMGNELEALSIGDEDLPRFIGRPISASNRKLLEEKLKGKKSRLGDDRQSSVQFQIPGLIYVDPDLHSIGRELTVEEIFATQAPDFADDIHAIQDDSDGN
DEQIPSDGDGDDDEDCYASFHPFLLDSARSRKRAPGEVQILLWVARFVYCGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021579 0 1
AT5G22450 unknown protein Lus10000530 5.6 1.0000
Lus10003536 7.9 1.0000
AT4G17220 ATMAP70-5 microtubule-associated protein... Lus10003908 9.6 1.0000
Lus10023589 10.6 1.0000
Lus10011078 10.8 1.0000
Lus10011832 12.0 1.0000
Lus10012998 12.4 1.0000
Lus10011425 13.2 1.0000
Lus10028667 13.5 1.0000
AT2G20420 ATP citrate lyase (ACL) family... Lus10022902 14.7 1.0000

Lus10021579 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.