Lus10021590 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G20500 180 / 2e-59 Glutaredoxin family protein (.1)
AT1G77370 135 / 5e-42 Glutaredoxin family protein (.1)
AT5G63030 94 / 1e-25 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1)
AT5G40370 93 / 3e-25 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2)
AT4G28730 92 / 3e-24 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1)
AT2G20270 92 / 4e-24 Thioredoxin superfamily protein (.1.2)
AT3G21460 67 / 3e-15 Glutaredoxin family protein (.1)
AT4G15700 67 / 4e-15 Thioredoxin superfamily protein (.1)
AT4G15690 66 / 9e-15 Thioredoxin superfamily protein (.1)
AT4G15680 66 / 1e-14 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017148 265 / 5e-93 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Lus10028355 136 / 3e-42 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1)
Lus10022253 106 / 1e-30 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10013089 105 / 2e-30 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Lus10001237 94 / 2e-25 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10042104 94 / 2e-25 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Lus10022844 90 / 2e-23 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1)
Lus10011915 71 / 3e-16 AT4G28730 154 / 4e-48 glutaredoxin C5, Glutaredoxin family protein (.1)
Lus10012815 67 / 5e-15 AT3G21460 171 / 3e-57 Glutaredoxin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G133400 194 / 3e-65 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1)
Potri.007G017300 138 / 8e-43 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1)
Potri.002G254100 99 / 8e-27 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1)
Potri.012G082800 97 / 9e-27 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.015G078900 92 / 8e-25 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1)
Potri.001G347700 88 / 2e-23 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2)
Potri.002G208500 68 / 1e-15 AT3G62950 171 / 5e-57 Thioredoxin superfamily protein (.1)
Potri.014G134200 68 / 2e-15 AT3G62950 169 / 4e-56 Thioredoxin superfamily protein (.1)
Potri.008G214500 66 / 6e-15 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.002G208400 63 / 9e-14 AT2G30540 160 / 8e-53 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10021590 pacid=23182085 polypeptide=Lus10021590 locus=Lus10021590.g ID=Lus10021590.BGIv1.0 annot-version=v1.0
ATGGCCAAAGTATCGTCGATATTCGCAGTTATTGCAACTCTGGTAGCTATAGGTGCGGTATCTTTTAGCTGGCCGTCAGCGTGTGCCGCTTCTCCGGAGT
CCGCTTTTGTCAAGAAGACCATCTCCTCTCACCAGATTGTTATATTTTCCAAGTCCTATTGCCCATACTGCAGGAGGGCTAAAGCTGTATTCAAAGAGTT
GAACCAAACACCATATGTGGTTGAGCTTGATGAGAGAGACGATGGGCATGACATCCAGGGTGCACTGGGTCAACTAGTAGGGAAACGCACTGTACCTCAG
GTTTTCATAAACGGTAAACACATTGGTGGCTCTGACGATACTGTTGAAGCATATGAAAATGGTGAACTGGAAACTCTTCTAGGGATTGACGTCGACGACG
AAAAGGATGATCTATGA
AA sequence
>Lus10021590 pacid=23182085 polypeptide=Lus10021590 locus=Lus10021590.g ID=Lus10021590.BGIv1.0 annot-version=v1.0
MAKVSSIFAVIATLVAIGAVSFSWPSACAASPESAFVKKTISSHQIVIFSKSYCPYCRRAKAVFKELNQTPYVVELDERDDGHDIQGALGQLVGKRTVPQ
VFINGKHIGGSDDTVEAYENGELETLLGIDVDDEKDDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G20500 Glutaredoxin family protein (.... Lus10021590 0 1
AT4G31050 Biotin/lipoate A/B protein lig... Lus10025664 7.5 0.7983
AT3G52500 Eukaryotic aspartyl protease f... Lus10021292 7.7 0.8004
AT3G10910 RING/U-box superfamily protein... Lus10022743 7.7 0.8069
AT3G06740 GATA GATA15 GATA transcription factor 15 (... Lus10037721 9.3 0.7690
AT2G37660 NAD(P)-binding Rossmann-fold s... Lus10010846 13.5 0.8300
AT5G61760 ATIPK2BETA ARABIDOPSIS THALIANA INOSITOL ... Lus10009385 16.9 0.8009
AT3G23760 unknown protein Lus10043212 19.1 0.8204
AT2G28900 OEP16, ATOEP16-... outer envelope protein 16, OUT... Lus10016545 21.5 0.7871
AT1G64690 BLT BRANCHLESS TRICHOMES, branchle... Lus10001665 21.6 0.7705
AT2G43630 unknown protein Lus10005311 29.0 0.7891

Lus10021590 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.