Lus10021591 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43890 67 / 6e-14 Pectin lyase-like superfamily protein (.1)
AT3G59850 67 / 8e-14 Pectin lyase-like superfamily protein (.1)
AT2G43870 67 / 8e-14 Pectin lyase-like superfamily protein (.1)
AT2G43860 59 / 7e-11 Pectin lyase-like superfamily protein (.1)
AT1G05650 57 / 3e-10 Pectin lyase-like superfamily protein (.1)
AT1G65570 56 / 6e-10 Pectin lyase-like superfamily protein (.1)
AT2G43880 56 / 7e-10 Pectin lyase-like superfamily protein (.1)
AT1G05660 53 / 8e-09 Pectin lyase-like superfamily protein (.1)
AT1G78400 51 / 4e-08 Pectin lyase-like superfamily protein (.1)
AT1G43080 50 / 4e-08 Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002124 119 / 6e-33 AT2G43870 505 / 7e-180 Pectin lyase-like superfamily protein (.1)
Lus10022530 96 / 3e-24 AT2G43870 471 / 4e-166 Pectin lyase-like superfamily protein (.1)
Lus10002126 91 / 2e-22 AT2G43870 461 / 1e-162 Pectin lyase-like superfamily protein (.1)
Lus10011417 89 / 3e-22 AT2G43870 191 / 1e-58 Pectin lyase-like superfamily protein (.1)
Lus10002125 72 / 2e-15 AT3G59850 509 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011419 68 / 3e-14 AT2G43870 507 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10002123 67 / 6e-14 AT2G43870 498 / 5e-177 Pectin lyase-like superfamily protein (.1)
Lus10011418 118 / 2e-12 AT2G43870 499 / 2e-177 Pectin lyase-like superfamily protein (.1)
Lus10040610 48 / 3e-07 AT5G17200 346 / 7e-116 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G003500 92 / 1e-22 AT3G59850 498 / 4e-177 Pectin lyase-like superfamily protein (.1)
Potri.017G004500 92 / 1e-22 AT3G59850 520 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G005300 92 / 1e-22 AT3G59850 504 / 3e-179 Pectin lyase-like superfamily protein (.1)
Potri.007G144400 91 / 2e-22 AT3G59850 476 / 2e-168 Pectin lyase-like superfamily protein (.1)
Potri.017G005900 91 / 3e-22 AT3G59850 486 / 3e-172 Pectin lyase-like superfamily protein (.1)
Potri.007G144200 90 / 4e-22 AT3G59850 482 / 1e-170 Pectin lyase-like superfamily protein (.1)
Potri.017G005600 89 / 1e-21 AT3G59850 496 / 5e-176 Pectin lyase-like superfamily protein (.1)
Potri.007G144100 89 / 1e-21 AT2G43870 525 / 0.0 Pectin lyase-like superfamily protein (.1)
Potri.017G006200 86 / 1e-20 AT3G59850 503 / 7e-178 Pectin lyase-like superfamily protein (.1)
Potri.010G248200 85 / 3e-20 AT2G43870 534 / 0.0 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence
>Lus10021591 pacid=23182079 polypeptide=Lus10021591 locus=Lus10021591.g ID=Lus10021591.BGIv1.0 annot-version=v1.0
ATGAAAGGACCCTGTAAGAACAATGGCATCTTCATCAGAATCGACGACACCCTCGTCGCCCCTTCCGACATTCGGGCCATCGGGAATAACCCCAATTGGA
TCGGTTTCAAGTACGTTAACGTTGTCACCATCTCCGGCAGCGTCCTAGACGGTCAGGGCATTGGTTTGTGGGCTTGCAAAACCGCCGGCCGAAAATACTC
CACCGACGTTACGTCTGGGATTTTCGTTATGCAAGAATGTGTTGGTGAGCGGGTTGACTTCTCTGGACAGCCAGATGTTCCACATAGTGATAAACTACTT
ATTGGGAGTTTGGGAAAGGATGTGAAGGAGGCGGGAGTTCAGAACGTGACGATTAAGTCGACGACATTTACCGGAATGACGAACGGGGTGAGGATCAAGG
CATGA
AA sequence
>Lus10021591 pacid=23182079 polypeptide=Lus10021591 locus=Lus10021591.g ID=Lus10021591.BGIv1.0 annot-version=v1.0
MKGPCKNNGIFIRIDDTLVAPSDIRAIGNNPNWIGFKYVNVVTISGSVLDGQGIGLWACKTAGRKYSTDVTSGIFVMQECVGERVDFSGQPDVPHSDKLL
IGSLGKDVKEAGVQNVTIKSTTFTGMTNGVRIKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G43870 Pectin lyase-like superfamily ... Lus10021591 0 1

Lus10021591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.