Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64080 124 / 5e-36 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 107 / 2e-29 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G09370 87 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 86 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G36150 81 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 75 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 72 / 9e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 67 / 6e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G43720 61 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G03103 61 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039348 [exp] 82 / 7e-20 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 82 / 8e-20 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 77 / 8e-18 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 75 / 5e-17 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001153 [exp] 76 / 6e-17 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10008400 [exp] 69 / 5e-15 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 68 / 9e-15 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008401 [exp] 63 / 2e-12 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10035975 [exp] 62 / 2e-11 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G210100 [exp] 124 / 6e-36 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 118 / 8e-34 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G169000 [exp] 86 / 7e-21 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G092800 [exp] 81 / 6e-19 AT5G64080 84 / 3e-20 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155100 [exp] 76 / 2e-17 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 76 / 3e-17 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G158100 [exp] 66 / 2e-13 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.004G196000 [exp] 64 / 1e-12 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G211800 [exp] 58 / 1e-10 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 57 / 5e-10 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10021604 pacid=23182130 polypeptide=Lus10021604 locus=Lus10021604.g ID=Lus10021604.BGIv1.0 annot-version=v1.0 ATGGCATCATCTTCGTCCTACCTTGCTCTGTTCCTTGTCTCTTCTCTCCTCTTCCTCTCCGCCGCTAATGCAGCCCACCATCACTCCGCCGCTGCTCCTG CACCCGCCGCCGACTGCTCCACCGTCGTCCTTAGCCTCTCCGATTGCCTCACCTATGTACTCAACGGTAGCACCACCACTAAGCCCGAGGGCACTTGCTG TTCTGGTCTCAAGACCGTCCTCAAGAACGACGCTGCCTGCCTCTGCCAGGCCTTCCAGAGCAGCAGCCAGCTCGGCGTCCAGCTCAACATGACCAAGGCT CTTACCCTTCCTTCCGCTTGCAACCTCCAAGCACCCCCAATGTCCGCCTGTCAAATGTCTATGGCTCCTGCTGCTGCCCATGGACAAATTGGGACAGGTG GTGCATCAAGTGGAATTTCACCAACTGGGTCAGGGGAAGGAGGCGATGAGATGATTAAAGCTCCAGCACCATCTCCAGTTGGAGCTGGCTTAACTACTGG TTCAGCACCTGCTCTGCATTTCTCATTTGTTGCTGCAACCATTGTAGTTGCTGCTGCCGCTTTCTACTACACCTTTTGA
AA sequence Show only first row Show all	>Lus10021604 pacid=23182130 polypeptide=Lus10021604 locus=Lus10021604.g ID=Lus10021604.BGIv1.0 annot-version=v1.0 MASSSSYLALFLVSSLLFLSAANAAHHHSAAAPAPAADCSTVVLSLSDCLTYVLNGSTTTKPEGTCCSGLKTVLKNDAACLCQAFQSSSQLGVQLNMTKA LTLPSACNLQAPPMSACQMSMAPAAAHGQIGTGGASSGISPTGSGEGGDEMIKAPAPSPVGAGLTTGSAPALHFSFVAATIVVAAAAFYYTF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G64080		AtXYP1	xylogen protein 1, Bifunctiona...		Lus10021604 [exp]	0	1
AT3G17440		ATNPSN13, NPSN1...	novel plant snare 13 (.1.2)		Lus10017116 [exp]	1.0	0.8865
AT1G12310			Calcium-binding EF-hand family...		Lus10004332 [exp]	3.2	0.8863
AT4G18760		AtRLP51	receptor like protein 51 (.1)		Lus10015226 [exp]	3.5	0.8567
AT3G52300		ATPQ	"ATP synthase D chain, mitocho...		Lus10023337 [exp]	3.9	0.8469
AT1G66680		AR401	S-adenosyl-L-methionine-depend...		Lus10033577 [exp]	4.4	0.8041
AT3G54400			Eukaryotic aspartyl protease f...		Lus10039503 [exp]	5.5	0.8198
AT5G58590		RANBP1	RAN binding protein 1 (.1)		Lus10037242 [exp]	7.4	0.8286
AT5G23290		PFD5, PDF5	prefoldin 5 (.1)		Lus10010176 [exp]	7.5	0.7849
AT1G28120			unknown protein		Lus10030429 [exp]	7.9	0.8386
AT4G12420		SKU5	Cupredoxin superfamily protein...		Lus10028921 [exp]	8.5	0.8049

Compare expression of checked genes

Lus10021604 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.