Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023022 [exp] 85 / 2e-23 AT3G62770 46 / 7e-07 autophagy 18a, Transducin/WD40 repeat-like superfamily protein (.1.3) Lus10021853 [exp] 77 / 1e-19 ND / Lus10010849 [exp] 75 / 2e-19 ND / Lus10002504 [exp] 74 / 3e-18 ND / Lus10024147 [exp] 72 / 5e-18 ND / Lus10032492 [exp] 70 / 6e-18 ND / Lus10015574 [exp] 72 / 1e-17 ND / Lus10002049 [exp] 70 / 9e-17 ND / Lus10013569 [exp] 69 / 4e-16 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021608 pacid=23182128 polypeptide=Lus10021608 locus=Lus10021608.g ID=Lus10021608.BGIv1.0 annot-version=v1.0 ATGAGCCATTCGGAAAGTTATAATGACGATGATGATGTTGAGGAACATTTGAATTATGGCGTTTATTTCATGAACGGGGTGATTTACGACACAGTCGATG ATGCGTGTGATGCGGCTAAGGACATTGCTTTAGACTTAGGTTTCAATTGA
AA sequence Show only first row Show all	>Lus10021608 pacid=23182128 polypeptide=Lus10021608 locus=Lus10021608.g ID=Lus10021608.BGIv1.0 annot-version=v1.0 MSHSESYNDDDDVEEHLNYGVYFMNGVIYDTVDDACDAAKDIALDLGFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10021608 [exp]	0	1

Compare expression of checked genes

Lus10021608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.