Lus10021618 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G074150 108 / 5e-32 ND /
PFAM info
Representative CDS sequence
>Lus10021618 pacid=23182127 polypeptide=Lus10021618 locus=Lus10021618.g ID=Lus10021618.BGIv1.0 annot-version=v1.0
ATGGATAGATCACCCAGGTTCGGGTCCATAAGCAGTGACAATTGCCCTATGAAGACTCGCTTTCGCTACGGCTCCGGTGGGTTTCCCTTAACCAAGCCAC
TGCCTATGAGTCGCCGGCTCATTCTTCAACAGGCACGCGGTCAGAGCCCGAACAGGCACGCGGTCAGAGCCCCTGGCTCCTTCCACTGCTTGGGAGCTTA
CGGTTTCATGTTCTATTTCACTCCCCGACGGGGGTTCTTTTCACCCTTCCCTCACGGTACTACTTCGCTATCGGTCACCCAGGAGTATTTAGCCTTGCAA
GGGGGTCCTTGCTGA
AA sequence
>Lus10021618 pacid=23182127 polypeptide=Lus10021618 locus=Lus10021618.g ID=Lus10021618.BGIv1.0 annot-version=v1.0
MDRSPRFGSISSDNCPMKTRFRYGSGGFPLTKPLPMSRRLILQQARGQSPNRHAVRAPGSFHCLGAYGFMFYFTPRRGFFSPFPHGTTSLSVTQEYLALQ
GGPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021618 0 1
AT4G14740 Plant protein of unknown funct... Lus10002798 4.8 0.8931
AT5G67360 ARA12 Subtilase family protein (.1) Lus10029570 6.0 0.8863
AT4G25180 RNA polymerase III RPC4 (.1) Lus10000362 8.0 0.8347
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10042095 14.0 0.8609
AT1G13570 F-box/RNI-like superfamily pro... Lus10011048 14.3 0.8796
AT2G02850 ARPN plantacyanin (.1) Lus10028641 15.3 0.8188
AT3G45070 P-loop containing nucleoside t... Lus10034079 17.5 0.8420
AT1G71460 Pentatricopeptide repeat (PPR-... Lus10006174 18.9 0.7432
AT2G02950 PKS1 phytochrome kinase substrate 1... Lus10030480 19.7 0.8678
AT1G17930 Aminotransferase-like, plant m... Lus10027047 20.0 0.8589

Lus10021618 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.