Lus10021638 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 413 / 6e-147 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 407 / 1e-144 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT4G25810 372 / 1e-130 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 371 / 3e-130 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57560 363 / 4e-127 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G30270 359 / 5e-126 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 353 / 4e-123 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 351 / 2e-122 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT2G18800 338 / 8e-117 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT4G25820 335 / 3e-116 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000678 557 / 0 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 416 / 7e-148 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10008522 410 / 2e-145 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10004723 403 / 7e-143 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 376 / 3e-132 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010939 375 / 7e-132 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 374 / 2e-131 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 374 / 3e-131 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 372 / 9e-131 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 428 / 6e-153 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 415 / 1e-147 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201200 408 / 9e-145 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 405 / 7e-144 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 405 / 1e-143 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.011G077320 389 / 3e-137 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G060400 386 / 4e-136 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.013G005700 386 / 2e-135 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 382 / 1e-134 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 379 / 3e-133 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10021638 pacid=23180347 polypeptide=Lus10021638 locus=Lus10021638.g ID=Lus10021638.BGIv1.0 annot-version=v1.0
ATGGGTTTCTACTCTAGTCCATTTGGGGTACTAGTAGTGGGACTTGTGATCAGTTCTTGTATGGCAGGAGTTGCACTTGCGGGCAATTTCGACCAGGATT
TCGACTTAACATGGGGAGGGCCACGAGCTAAGATCTCAAATGGTGGTCGGGATTTGTCTCTGTCGCTAGACAATACCTCTGGCTCTGGATTTCAGTCCAA
GAAGGAGTACCTCTTTGGCAAGATAGACATGCAGCTTAAGCTCATCGCTGGCAACTCTGCCGGCACTGTCACTACTTACTACTTGTCATCTGAAGGGACT
ACACATGACGAAATCGACTTCGAATTTCTAGGAAACCTGAGCGGAGACCCGTACATTATCCACACCAACGTATTTAGCCAAGGCAAAGGAAACAGAGAGC
AACAATTCTACTTATGGTTCGACCCGACACAAGACTACCATACTTACTCTGTCATATGGCTCCCACACCACATCGTGTTCTTGGTGGACAATACTCCTAT
TAGGGTTTTCAAAAACTCTGAGGCCATGGGAGTACCTTTCCCCAAAAGCCAGCCCATGAAGATCCACTCAAGCCTGTGGAATGCAGATGATTGGGCTACC
CGTGGAGGGCTGGTCAAGACCGATTGGTCGAAGGCTCCGTTCACAGCCTACTATCGTAACTTCAATTCTCTTGAGGTTTCGAAAATGGTGTCACCGAAAT
CATTTTCGGATGGGAATTGGGAGTCGAAGGAGTTGGACGACAAGGCAAGGAGGAGAGTGAGGTGGGTACAGAAGAACTACATGATTTACAACTATTGCAC
AGACCTTAAGCGCTTCCCCCAAGGTTTTCCTGTGGAGTGTCGATCATGA
AA sequence
>Lus10021638 pacid=23180347 polypeptide=Lus10021638 locus=Lus10021638.g ID=Lus10021638.BGIv1.0 annot-version=v1.0
MGFYSSPFGVLVVGLVISSCMAGVALAGNFDQDFDLTWGGPRAKISNGGRDLSLSLDNTSGSGFQSKKEYLFGKIDMQLKLIAGNSAGTVTTYYLSSEGT
THDEIDFEFLGNLSGDPYIIHTNVFSQGKGNREQQFYLWFDPTQDYHTYSVIWLPHHIVFLVDNTPIRVFKNSEAMGVPFPKSQPMKIHSSLWNADDWAT
RGGLVKTDWSKAPFTAYYRNFNSLEVSKMVSPKSFSDGNWESKELDDKARRRVRWVQKNYMIYNYCTDLKRFPQGFPVECRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10021638 0 1
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Lus10020511 5.2 0.7320
AT5G03100 F-box/RNI-like superfamily pro... Lus10029952 7.7 0.7043
AT3G13890 MYB ATMYB26, MS35 MALE STERILE 35, myb domain pr... Lus10015608 8.8 0.7016
AT3G51550 FER FERONIA, Malectin/receptor-lik... Lus10022104 9.2 0.6995
AT1G60830 RNA-binding (RRM/RBD/RNP motif... Lus10011201 10.1 0.6866
Lus10021381 11.4 0.6940
AT1G47710 Serine protease inhibitor (SER... Lus10040926 16.1 0.6844
AT1G18330 MYB RVE7, EPR1 REVEILLE 7, EARLY-PHYTOCHROME-... Lus10026365 16.2 0.6456
AT4G08300 nodulin MtN21 /EamA-like trans... Lus10022187 18.3 0.6752
AT3G25610 ATPase E1-E2 type family prote... Lus10017901 20.8 0.5753

Lus10021638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.