Lus10021639 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26570 145 / 7e-43 UGD1, ATUGD1 UDP-glucose dehydrogenase 1 (.1)
AT5G15490 136 / 1e-39 UGD3 UDP-glucose dehydrogenase 3, UDP-glucose 6-dehydrogenase family protein (.1)
AT3G29360 132 / 5e-38 UGD2 UDP-glucose dehydrogenase 2, UDP-glucose 6-dehydrogenase family protein (.1.2)
AT5G39320 129 / 5e-37 UDP-glucose 6-dehydrogenase family protein (.1)
AT3G01010 119 / 8e-36 UDP-glucose/GDP-mannose dehydrogenase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034703 167 / 2e-51 AT5G15490 882 / 0.0 UDP-glucose dehydrogenase 3, UDP-glucose 6-dehydrogenase family protein (.1)
Lus10021626 166 / 1e-50 AT5G15490 875 / 0.0 UDP-glucose dehydrogenase 3, UDP-glucose 6-dehydrogenase family protein (.1)
Lus10026656 139 / 1e-40 AT1G26570 868 / 0.0 UDP-glucose dehydrogenase 1 (.1)
Lus10004656 137 / 1e-39 AT1G26570 864 / 0.0 UDP-glucose dehydrogenase 1 (.1)
Lus10036887 131 / 1e-39 AT3G29360 444 / 5e-157 UDP-glucose dehydrogenase 2, UDP-glucose 6-dehydrogenase family protein (.1.2)
Lus10037096 132 / 3e-38 AT1G26570 815 / 0.0 UDP-glucose dehydrogenase 1 (.1)
Lus10026657 132 / 3e-37 AT1G26570 856 / 0.0 UDP-glucose dehydrogenase 1 (.1)
Lus10004657 58 / 3e-12 AT5G15490 133 / 4e-38 UDP-glucose dehydrogenase 3, UDP-glucose 6-dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G118600 142 / 5e-42 AT5G15490 879 / 0.0 UDP-glucose dehydrogenase 3, UDP-glucose 6-dehydrogenase family protein (.1)
Potri.010G159800 132 / 3e-38 AT5G15490 853 / 0.0 UDP-glucose dehydrogenase 3, UDP-glucose 6-dehydrogenase family protein (.1)
Potri.008G094300 130 / 3e-37 AT3G29360 858 / 0.0 UDP-glucose dehydrogenase 2, UDP-glucose 6-dehydrogenase family protein (.1.2)
Potri.017G092000 129 / 6e-37 AT3G29360 898 / 0.0 UDP-glucose dehydrogenase 2, UDP-glucose 6-dehydrogenase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF03720 UDPG_MGDP_dh_C UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain
Representative CDS sequence
>Lus10021639 pacid=23180319 polypeptide=Lus10021639 locus=Lus10021639.g ID=Lus10021639.BGIv1.0 annot-version=v1.0
ATGAGCTGCAACTGGACAAGCGTAAAAGAACAAGTGAGCATAGTGTCGGATGCGTACGAGGCTACGAAGGATGCTCACGGTGTGTACATTCTGACCGAGT
GGGATGAGTTCAAGAAACTATACTACAAAAAGATATACGACAAGATGCAAAAGCCAGCATTTGTGTTTCATGGGAGGAAGGTGGTTGATGCTGCAAAGTT
GAGGGAGATTGGTTTCATTGTTTACTCCATTGGGAAGCCTTTGGATAATTGGCTCCAGGACTTGCCTGGTTTGGCTTGA
AA sequence
>Lus10021639 pacid=23180319 polypeptide=Lus10021639 locus=Lus10021639.g ID=Lus10021639.BGIv1.0 annot-version=v1.0
MSCNWTSVKEQVSIVSDAYEATKDAHGVYILTEWDEFKKLYYKKIYDKMQKPAFVFHGRKVVDAAKLREIGFIVYSIGKPLDNWLQDLPGLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26570 UGD1, ATUGD1 UDP-glucose dehydrogenase 1 (.... Lus10021639 0 1
AT5G15430 Plant calmodulin-binding prote... Lus10003472 4.1 0.9635
Lus10015828 6.5 0.9613
AT5G15430 Plant calmodulin-binding prote... Lus10000141 8.5 0.9575
AT3G15510 NAC ATNAC2, ANAC056... NAC-REGULATED SEED MORPHOLOGY ... Lus10036117 9.5 0.8498
AT5G03610 GDSL-like Lipase/Acylhydrolase... Lus10028145 9.8 0.9547
AT2G03200 Eukaryotic aspartyl protease f... Lus10022917 10.5 0.9537
AT1G11340 S-locus lectin protein kinase ... Lus10036139 12.5 0.9525
Lus10019410 13.7 0.9459
AT2G27410 B3 Domain of unknown function (DU... Lus10027284 14.5 0.9507
AT2G33530 SCPL46 serine carboxypeptidase-like 4... Lus10040326 14.8 0.9449

Lus10021639 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.