Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51980 146 / 7e-42 C3HZnF Transducin/WD40 repeat-like superfamily protein (.1.2) AT4G25440 145 / 1e-41 C3HZnF ZFWD1 zinc finger WD40 repeat protein 1 (.1) AT5G49200 116 / 8e-31 C3HZnF WD-40 repeat family protein / zfwd4 protein (ZFWD4) (.1) AT5G40880 109 / 6e-28 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1) AT3G51930 54 / 2e-08 Transducin/WD40 repeat-like superfamily protein (.1) AT3G49660 46 / 5e-06 AtWDR5a human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1) AT1G47610 45 / 9e-06 Transducin/WD40 repeat-like superfamily protein (.1) AT5G25150 45 / 1e-05 TAF5 TBP-associated factor 5 (.1) AT2G26490 44 / 5e-05 Transducin/WD40 repeat-like superfamily protein (.1) AT1G49040 44 / 5e-05 SCD1 STOMATAL CYTOKINESIS-DEFECTIVE 1, stomatal cytokinesis defective / SCD1 protein (SCD1) (.1), stomatal cytokinesis defective / SCD1 protein (SCD1) (.2), stomatal cytokinesis defective / SCD1 protein (SCD1) (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021648 [exp] 357 / 2e-123 AT4G25440 321 / 1e-105 zinc finger WD40 repeat protein 1 (.1) Lus10001652 [exp] 305 / 7e-107 AT5G51980 192 / 2e-59 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10021656 [exp] 276 / 2e-91 AT4G25440 329 / 9e-109 zinc finger WD40 repeat protein 1 (.1) Lus10021655 [exp] 259 / 4e-86 AT4G25440 169 / 3e-48 zinc finger WD40 repeat protein 1 (.1) Lus10034716 [exp] 229 / 4e-75 AT5G51980 217 / 5e-67 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10014595 [exp] 235 / 3e-73 AT5G14250 445 / 3e-150 FUSCA 11, COP9 SIGNALOSOME SUBUNIT 3, CONSTITUTIVE PHOTOMORPHOGENIC 13, Proteasome component (PCI) domain protein (.1), Proteasome component (PCI) domain protein (.2) Lus10032066 [exp] 226 / 8e-73 AT4G25440 343 / 5e-115 zinc finger WD40 repeat protein 1 (.1) Lus10032062 [exp] 223 / 1e-72 AT4G25440 212 / 3e-65 zinc finger WD40 repeat protein 1 (.1) Lus10033255 [exp] 187 / 8e-57 AT5G51980 285 / 3e-91 Transducin/WD40 repeat-like superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G077800 [exp] 149 / 2e-42 AT5G51980 391 / 5e-132 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.015G137200 [exp] 144 / 9e-41 AT4G25440 587 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.012G134800 [exp] 142 / 2e-40 AT4G25440 600 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.002G130400 [exp] 47 / 4e-06 AT2G26490 632 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.012G060800 [exp] 46 / 1e-05 AT1G49040 1782 / 0.0 STOMATAL CYTOKINESIS-DEFECTIVE 1, stomatal cytokinesis defective / SCD1 protein (SCD1) (.1), stomatal cytokinesis defective / SCD1 protein (SCD1) (.2), stomatal cytokinesis defective / SCD1 protein (SCD1) (.3) Potri.003G202700 [exp] 45 / 1e-05 AT3G51930 531 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.001G022900 [exp] 45 / 1e-05 AT3G51930 523 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.014G038400 [exp] 45 / 2e-05 AT2G26490 631 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1) Potri.015G049500 [exp] 45 / 2e-05 AT1G49040 1810 / 0.0 STOMATAL CYTOKINESIS-DEFECTIVE 1, stomatal cytokinesis defective / SCD1 protein (SCD1) (.1), stomatal cytokinesis defective / SCD1 protein (SCD1) (.2), stomatal cytokinesis defective / SCD1 protein (SCD1) (.3) Potri.005G148500 [exp] 44 / 3e-05 AT3G49660 503 / 0.0 human WDR5 \(WD40 repeat\) homolog a, Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10021640 pacid=23180296 polypeptide=Lus10021640 locus=Lus10021640.g ID=Lus10021640.BGIv1.0 annot-version=v1.0 ATGACGATTGTGTTTGCTGCCGCTGAAGATGGTATCATTTGGGCGTGGAAGACTAATACCGACGAGCACGGAAATATTTTCCAGCCAACTGCATCACTGA TAGGCCATACAAGTGCAGTTATTTCCCTGAGGTCTGGAGCAGGTAGTAGGGTGTATTCGGGTTCCATAGATGGAACCATCAAAGTTTGGGATGGTAGAAC TTCTCAATGCATACAAACATTAAAGGGGCATGATGATGCAGTGACGTGTCTCCTCTGCTATAGATGCTACTTGTTGTCCTGCTCACTGGATAAGAAGATA AAAGTATGGGGTCACAATAAAGAAAGAAGACTGGAAGTTGAATATACCCATGAAGAAGCAGATGGTGGTCTAGCTTTGTGTGGAATAGAAGAGTGTGGGA AAGAGATGTTGTTGTGCTCTTGGAACAATGATTCGGTTGGATTGTATGAGCTTCCGTCATTTGTTGAGAAAGGGAGAATGTACATGAAATGTGAAGTAAG GAGCTTGGGGGGAGGTACTGGAGGGATGTTCTTCACTGGAGATGCTTCTGGTGTGGTGACTGTATGGAAACTTGCAGAAGAAGCAAAAAATGGAGCAGTA GAAGTAGTAGTTTGA
AA sequence Show only first row Show all	>Lus10021640 pacid=23180296 polypeptide=Lus10021640 locus=Lus10021640.g ID=Lus10021640.BGIv1.0 annot-version=v1.0 MTIVFAAAEDGIIWAWKTNTDEHGNIFQPTASLIGHTSAVISLRSGAGSRVYSGSIDGTIKVWDGRTSQCIQTLKGHDDAVTCLLCYRCYLLSCSLDKKI KVWGHNKERRLEVEYTHEEADGGLALCGIEECGKEMLLCSWNNDSVGLYELPSFVEKGRMYMKCEVRSLGGGTGGMFFTGDASGVVTVWKLAEEAKNGAV EVVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10021640 [exp]	0	1
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10021648 [exp]	1.4	0.8418
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10026047 [exp]	2.8	0.8059
AT1G76570			Chlorophyll A-B binding family...		Lus10005421 [exp]	3.0	0.8142
AT3G29090		PME31, ATPME31	A. THALIANA PECTIN METHYLESTER...		Lus10014338 [exp]	3.5	0.8172
AT3G63440		ATCKX6, CKX6, A...	CYTOKININ OXIDASE 6, cytokinin...		Lus10039574 [exp]	9.5	0.7747
AT4G25720		ATQC, QCT	GLUTAMINYL CYCLOTRANSFERASE, A...		Lus10038844 [exp]	10.8	0.6970
AT1G51200			A20/AN1-like zinc finger famil...		Lus10031833 [exp]	11.0	0.7943
AT1G20920			P-loop containing nucleoside t...		Lus10025525 [exp]	11.5	0.7716
AT3G09032			unknown protein		Lus10027777 [exp]	11.8	0.7989
AT4G13200			unknown protein		Lus10011869 [exp]	16.0	0.7894

Compare expression of checked genes

Lus10021640 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.