Lus10021653 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61220 105 / 4e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034706 184 / 4e-62 AT5G61220 104 / 5e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Lus10003467 168 / 6e-56 AT5G61220 104 / 6e-31 LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G079800 148 / 3e-48 AT5G61220 97 / 7e-28 LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0491 LYR-like PF05347 Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence
>Lus10021653 pacid=23180345 polypeptide=Lus10021653 locus=Lus10021653.g ID=Lus10021653.BGIv1.0 annot-version=v1.0
ATGGCGTCGACCAGAAGCGTATCAAGAGGCGAAATACTCTCCCTTTACCGTTCCCTCCTGCGCACAGCTCGCCAGTTTAGCGACTACAACATCCGGGAGT
ACGCCAAGCGGCGTACGGTCGATGGCTTCCGGCAGAACCAAGGTTTAACGGACTCCGTTTCCGTTTCCGCCGCATACTCGGACGGGAAGTCTCAACTCGA
AGTCGCCAAGAGACAGGCTGTCGTGTACTCTCTCTACGCCCCTAAAATCAAGAGCGTGATGGAGACCGACTTGAAAGGCAAGCGCTGA
AA sequence
>Lus10021653 pacid=23180345 polypeptide=Lus10021653 locus=Lus10021653.g ID=Lus10021653.BGIv1.0 annot-version=v1.0
MASTRSVSRGEILSLYRSLLRTARQFSDYNIREYAKRRTVDGFRQNQGLTDSVSVSAAYSDGKSQLEVAKRQAVVYSLYAPKIKSVMETDLKGKR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61220 LYR family of Fe/S cluster bio... Lus10021653 0 1
AT1G07070 Ribosomal protein L35Ae family... Lus10021121 4.5 0.8350
AT2G27970 CKS2 CDK-subunit 2 (.1) Lus10021405 7.3 0.8321
AT1G76860 Small nuclear ribonucleoprotei... Lus10011293 7.9 0.8264
AT1G76860 Small nuclear ribonucleoprotei... Lus10040487 20.7 0.8087
AT2G47640 Small nuclear ribonucleoprotei... Lus10013840 25.1 0.7758
AT5G20850 ATRAD51 RAS associated with diabetes p... Lus10027654 27.5 0.8179
AT2G21060 ATCSP4, ATGRP2B COLD SHOCK DOMAIN PROTEIN 4, g... Lus10025058 29.2 0.7980
AT1G78650 POLD3 DNA-directed DNA polymerases (... Lus10013748 31.6 0.7955
AT3G18880 Nucleic acid-binding, OB-fold-... Lus10017467 31.6 0.7914
AT4G11080 3xHMG-box1 3xHigh Mobility Group-box1, HM... Lus10033951 34.1 0.8049

Lus10021653 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.