Lus10021667 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47530 140 / 4e-39 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G13270 128 / 1e-34 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G47580 117 / 5e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G11290 120 / 6e-32 CRR22 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G25360 119 / 2e-31 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G33170 118 / 3e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G02980 118 / 3e-31 OTP85 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22690 116 / 1e-30 unknown protein
AT1G04840 114 / 5e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G31920 114 / 1e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000274 187 / 1e-58 AT3G47530 554 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10003325 158 / 1e-46 AT2G41080 570 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10024222 155 / 8e-45 AT1G74630 719 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028106 135 / 5e-37 AT1G25360 916 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10028413 128 / 1e-34 AT2G25580 447 / 8e-150 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10041867 127 / 2e-34 AT2G25580 447 / 2e-149 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031423 116 / 2e-30 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10038400 116 / 2e-30 AT3G57430 1097 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10017583 115 / 3e-30 AT5G66520 481 / 2e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G074500 153 / 7e-44 AT3G47530 750 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.014G038900 142 / 9e-41 AT2G15690 280 / 1e-88 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G245300 133 / 2e-36 AT3G22690 570 / 0.0 unknown protein
Potri.016G077700 121 / 2e-32 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G252400 120 / 3e-32 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.013G044700 120 / 7e-32 AT3G22690 582 / 0.0 unknown protein
Potri.003G058300 119 / 1e-31 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G116600 117 / 9e-31 AT2G25580 452 / 3e-151 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G047800 117 / 9e-31 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G075800 117 / 1e-30 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10021667 pacid=23180338 polypeptide=Lus10021667 locus=Lus10021667.g ID=Lus10021667.BGIv1.0 annot-version=v1.0
ATGAGTAGTAGAGAGTTTGGGATTCAACCAAACATTCATCACTATAGATGCATGGTCGATCTGATGGGCCGCGTGGGGAAGCTCGACCAAGCATACAAGC
TGATAATGTCGATGAAACTGGTGAAGCCGGATTCAGCAATATGGAGGACTCTACTTGCAGCTTGTAGAATCCATCGCCATGTCACGCTGGGAGAACGAGT
GGTGGAGCATTTGGTTGAGCTCAAGGCTCAGGAAGCCGGGGACTATATGCTATTGTTGAACATGTATTCTTCAGTTGGGGAAGAAAAGGGTCATGTGCTT
TCTTATCACAGCGAAAAGTTAGCAATGGCATTTGGGATTCTTGAAACTCCACCTGGAACGACGATAAGGATAGCTAAGAACCTGAGGACCTGTGTTGACT
GCCACAACTTTGCAAAGTCTGTTTCCTGGGTGTACAATAGAGAGGTAGTCATAAGAGATCGAAACCGATTTCATCATTTTCGCGAAGGACATTGCTCCTG
CAACGACTTCTGGTAG
AA sequence
>Lus10021667 pacid=23180338 polypeptide=Lus10021667 locus=Lus10021667.g ID=Lus10021667.BGIv1.0 annot-version=v1.0
MSSREFGIQPNIHHYRCMVDLMGRVGKLDQAYKLIMSMKLVKPDSAIWRTLLAACRIHRHVTLGERVVEHLVELKAQEAGDYMLLLNMYSSVGEEKGHVL
SYHSEKLAMAFGILETPPGTTIRIAKNLRTCVDCHNFAKSVSWVYNREVVIRDRNRFHHFREGHCSCNDFW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G02980 OTP85 ORGANELLE TRANSCRIPT PROCESSIN... Lus10021667 0 1
AT5G07840 PIA1 phytochrome interacting ankyri... Lus10018958 1.7 0.9122
AT5G03730 AtCTR1, SIS1, C... SUGAR-INSENSITIVE 1, CONSTITUT... Lus10043428 3.5 0.8698
AT2G46080 unknown protein Lus10036385 3.5 0.9025
AT1G13570 F-box/RNI-like superfamily pro... Lus10016297 3.9 0.8873
AT5G53120 SPMS, SPDS3, AT... spermidine synthase 3 (.1.2.3.... Lus10019016 4.0 0.8680
AT5G11680 unknown protein Lus10027000 7.3 0.8951
AT1G07260 UGT71C3 UDP-glucosyl transferase 71C3 ... Lus10027334 8.4 0.8835
AT5G51410 LUC7 N_terminus domain-contain... Lus10031732 10.7 0.8861
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Lus10002228 13.9 0.8815
AT1G52240 PIRF1, ATROPGEF... phytochrome interacting RopGEF... Lus10035868 16.4 0.8277

Lus10021667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.