Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05370 76 / 3e-20 Cytochrome b-c1 complex, subunit 8 protein (.1) AT3G10860 74 / 1e-19 Cytochrome b-c1 complex, subunit 8 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035013 [exp] 115 / 3e-36 AT5G05370 75 / 6e-20 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10019118 [exp] 80 / 3e-22 AT3G10860 96 / 2e-28 Cytochrome b-c1 complex, subunit 8 protein (.1) Lus10034442 [exp] 80 / 4e-22 AT3G10860 115 / 6e-36 Cytochrome b-c1 complex, subunit 8 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G159700 [exp] 79 / 9e-22 AT3G10860 120 / 8e-38 Cytochrome b-c1 complex, subunit 8 protein (.1) Potri.019G132000 [exp] 78 / 2e-21 AT5G05370 124 / 3e-39 Cytochrome b-c1 complex, subunit 8 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0429 [flax] [poplar] UcrQ-like PF10890 [flax] [poplar] Cyt_b-c1_8 Cytochrome b-c1 complex subunit 8
Representative CDS sequence Show only first row Show all	>Lus10021674 pacid=23180270 polypeptide=Lus10021674 locus=Lus10021674.g ID=Lus10021674.BGIv1.0 annot-version=v1.0 ATGGCGAAGGTGAGAATGAAAGCCGTGATCTACGCGCTGTCCCCTTTCCAGCAGACGACGATGTCCGGCCTCTATAGAGAACTGCCTTCGAAGATCCACC ACAAGGTGTTCGACAATTGGCACGGCGTATCCCTCCTCTTCGCCCCTCTCATCGGCGTCTACTCGTAA
AA sequence Show only first row Show all	>Lus10021674 pacid=23180270 polypeptide=Lus10021674 locus=Lus10021674.g ID=Lus10021674.BGIv1.0 annot-version=v1.0 MAKVRMKAVIYALSPFQQTTMSGLYRELPSKIHHKVFDNWHGVSLLFAPLIGVYS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05370			Cytochrome b-c1 complex, subun...		Lus10021674 [exp]	0	1
AT2G14830			Regulator of Vps4 activity in ...		Lus10018577 [exp]	2.0	0.6916
AT3G24310	MYB	MYB305, ATMYB71	MYB DOMAIN PROTEIN 71, myb dom...		Lus10014453 [exp]	20.8	0.7300
AT1G70710		CEL1 ,AtGH9B1	CELLULASE 1, glycosyl hydrolas...		Lus10027205 [exp]	52.2	0.6263
AT2G35612			unknown protein		Lus10034745 [exp]	53.8	0.6720
AT1G02400		ATGA2OX4, ATGA2...	DOWNSTREAM TARGET OF AGL15 1, ...		Lus10004511 [exp]	69.0	0.6271
AT2G06010		ORG4	OBP3-responsive gene 4 (.1)		Lus10029795 [exp]	85.0	0.6564
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10036696 [exp]	115.3	0.6403
					Lus10002730 [exp]	219.5	0.5982
AT4G18220			Drug/metabolite transporter su...		Lus10028132 [exp]	264.0	0.5883

Compare expression of checked genes

Lus10021674 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.