Lus10021677 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68552 41 / 9e-06 CPuORF53 conserved peptide upstream open reading frame 53 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035017 130 / 5e-41 AT1G68552 49 / 7e-09 conserved peptide upstream open reading frame 53 (.1)
Lus10041455 82 / 1e-21 AT1G68552 56 / 2e-11 conserved peptide upstream open reading frame 53 (.1)
Lus10034317 78 / 6e-20 AT1G68552 56 / 2e-11 conserved peptide upstream open reading frame 53 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G125700 46 / 1e-07 AT1G25472 / conserved peptide upstream open reading frame 54 (.1)
PFAM info
Representative CDS sequence
>Lus10021677 pacid=23180282 polypeptide=Lus10021677 locus=Lus10021677.g ID=Lus10021677.BGIv1.0 annot-version=v1.0
ATGTCGGCTGAGTTTGATTTGGCTGTAGTGCTTGGGTCTTCTTCTATTTCGATTTACTCCTCAAAAGCTATAGCTTCTGCTGCCTGCTGCTTCATTTTCC
CCGCCGTGGCCGCTCTCCGTCGCTGCTGTTACACTCGACATAAGCTTCTCTGCTGTTCCCAGCAGAGCTCTCTTCTGAGGCCCGCGTCCACTTCGATGCG
TTTGAGGCCAAGGCGGACTTCTTCTGGTGTGGAGTGTTTTGGGGGTTTTCACATAAACCGATTCTGTAATTTATTCCTGTTCTTGAGAGGGGGTCTCACT
TGA
AA sequence
>Lus10021677 pacid=23180282 polypeptide=Lus10021677 locus=Lus10021677.g ID=Lus10021677.BGIv1.0 annot-version=v1.0
MSAEFDLAVVLGSSSISIYSSKAIASAACCFIFPAVAALRRCCYTRHKLLCCSQQSSLLRPASTSMRLRPRRTSSGVECFGGFHINRFCNLFLFLRGGLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10021677 0 1
AT1G68552 CPuORF53 conserved peptide upstream ope... Lus10035017 1.0 0.9719
AT3G25890 AP2_ERF CRF11 cytokinin response factor 11, ... Lus10021678 2.0 0.9518
AT3G46740 MAR1, TOC75-III... MODIFIER OF ARG1 1, translocon... Lus10004978 2.0 0.9348
AT3G25890 AP2_ERF CRF11 cytokinin response factor 11, ... Lus10035018 3.9 0.9295
AT3G03710 PDE326, PNP, RI... resistant to inhibition with F... Lus10001331 5.2 0.9351
AT3G15140 Polynucleotidyl transferase, r... Lus10009194 5.3 0.9203
AT5G07900 Mitochondrial transcription te... Lus10040817 6.5 0.9004
AT2G02750 Pentatricopeptide repeat (PPR)... Lus10030787 7.3 0.9222
AT1G06950 ATTIC110, TIC11... ARABIDOPSIS THALIANA TRANSLOCO... Lus10026424 12.6 0.9151
Lus10036489 13.7 0.9127

Lus10021677 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.