Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25855 94 / 2e-26 Copper transport protein family (.1) AT5G60800 43 / 6e-06 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G02960 40 / 8e-05 Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 37 / 0.0004 Heavy metal transport/detoxification superfamily protein (.1) AT2G28090 37 / 0.0005 Heavy metal transport/detoxification superfamily protein (.1) AT2G36950 37 / 0.0006 Heavy metal transport/detoxification superfamily protein (.1) AT1G57780 37 / 0.0007 heavy-metal-associated domain-containing protein (.1) AT1G06330 37 / 0.001 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035027 [exp] 155 / 5e-50 AT3G25855 113 / 5e-33 Copper transport protein family (.1) Lus10021432 [exp] 42 / 2e-05 AT5G60800 158 / 1e-46 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10021516 [exp] 42 / 3e-05 AT5G03380 202 / 2e-61 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10032923 [exp] 41 / 3e-05 AT5G24580 313 / 1e-106 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10015583 [exp] 41 / 4e-05 AT5G24580 314 / 6e-107 Heavy metal transport/detoxification superfamily protein (.1.2.3) Lus10016133 [exp] 41 / 5e-05 AT5G60800 175 / 3e-52 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014421 [exp] 40 / 0.0001 AT5G03380 193 / 5e-57 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10009116 [exp] 39 / 0.0002 AT2G02000 248 / 3e-75 glutamate decarboxylase 3 (.1) Lus10028529 [exp] 39 / 0.0002 AT1G23000 81 / 4e-17 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G119200 [exp] 107 / 5e-32 AT3G25855 105 / 9e-31 Copper transport protein family (.1) Potri.004G214700 [exp] 45 / 1e-06 AT5G60800 142 / 7e-40 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.009G007600 [exp] 45 / 1e-06 AT5G60800 157 / 1e-45 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.006G124800 [exp] 42 / 9e-06 AT2G36950 135 / 2e-36 Heavy metal transport/detoxification superfamily protein (.1) Potri.012G007300 [exp] 41 / 4e-05 AT5G24580 251 / 5e-82 Heavy metal transport/detoxification superfamily protein (.1.2.3) Potri.016G006600 [exp] 39 / 0.0001 AT5G50740 153 / 5e-45 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.002G092200 [exp] 39 / 0.0001 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G006100 [exp] 38 / 0.0003 AT5G50740 143 / 2e-41 Heavy metal transport/detoxification superfamily protein (.1.2.3.4) Potri.016G093100 [exp] 38 / 0.0003 AT2G36950 123 / 5e-32 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 37 / 0.0004 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021687 pacid=23180261 polypeptide=Lus10021687 locus=Lus10021687.g ID=Lus10021687.BGIv1.0 annot-version=v1.0 ATGGTGATGAGACTGAATCTGGACTGCAACTCTTGCTGCAGGAAAGCAAGCAGGGTCATCCACCAAATCAAAGGGGTGGAGACGCATATGATAGACAAGG AGCAATGCGTGGTGACGGTGTGCGGGAGATTCAGGGCGTCCGACGTGGCCATCAAGCTCCGGAAGAAGATGAAGCGTAGAGTCGAAATCCTCGAGATTCA GGAGTTCGGCGGCGGCGGGGATCAACCTCCTGATCAATATCCAATTGGGCCTCCTGCTCATCCTCCCATCTACTTTGCTAACGCTAATGGCGGGTGA
AA sequence Show only first row Show all	>Lus10021687 pacid=23180261 polypeptide=Lus10021687 locus=Lus10021687.g ID=Lus10021687.BGIv1.0 annot-version=v1.0 MVMRLNLDCNSCCRKASRVIHQIKGVETHMIDKEQCVVTVCGRFRASDVAIKLRKKMKRRVEILEIQEFGGGGDQPPDQYPIGPPAHPPIYFANANGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25855			Copper transport protein famil...		Lus10021687 [exp]	0	1
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10040735 [exp]	2.8	0.9314
AT2G18196			Heavy metal transport/detoxifi...		Lus10008284 [exp]	3.6	0.9321
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10027846 [exp]	5.7	0.9217
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Lus10014301 [exp]	6.9	0.8919
AT1G29380			Carbohydrate-binding X8 domain...		Lus10015259 [exp]	10.2	0.9121
AT1G67950			RNA-binding (RRM/RBD/RNP motif...		Lus10034580 [exp]	10.7	0.8872
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Lus10039864 [exp]	11.0	0.9187
AT3G54140		ATPTR1	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10024300 [exp]	12.2	0.8751
					Lus10000650 [exp]	12.8	0.8921
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Lus10033405 [exp]	13.3	0.9201

Compare expression of checked genes

Lus10021687 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.