Lus10021689 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021689 pacid=23180356 polypeptide=Lus10021689 locus=Lus10021689.g ID=Lus10021689.BGIv1.0 annot-version=v1.0
ATGGTCTATGGTCGATCTGGAGGCTTGCTCCGGAGAGAGTCTGCTGCTGAAGCCTATAGTAACCTGGGCACAATGTCTATCATGCTGAAACTCTTATGTG
AACTAAGAAGTATAGAGACTGCAATCTGTAAGAATAAAGTTGGAAACTGGGTAGGAAGGGGAGGAATCACATGGTTTGAGCCTCGAGGAACAAGCAGGCT
CTATTCCATCAATTGGTTACATACCATTTCAGGAGACCTGACATCGCCAGGATATATGAAGCAAATGAAGGACTTGGTGAAAATGGTATTTGCTTTTATC
ATTCTCCTTCTGTTTGGTCATACTGTCGATCTGGCTGGCATCACTCAAGCTTGGAGGAAATGGAACTGA
AA sequence
>Lus10021689 pacid=23180356 polypeptide=Lus10021689 locus=Lus10021689.g ID=Lus10021689.BGIv1.0 annot-version=v1.0
MVYGRSGGLLRRESAAEAYSNLGTMSIMLKLLCELRSIETAICKNKVGNWVGRGGITWFEPRGTSRLYSINWLHTISGDLTSPGYMKQMKDLVKMVFAFI
ILLLFGHTVDLAGITQAWRKWN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021689 0 1
AT2G44180 MAP2A methionine aminopeptidase 2A (... Lus10000403 1.7 0.9511
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10034468 2.4 0.9508
AT1G76710 ASHH1 ,SDG26 ASH1-RELATED PROTEIN 1, ASH1 R... Lus10016600 3.2 0.9370
AT1G02860 BAH1, NLA nitrogen limitation adaptation... Lus10030375 4.9 0.9444
AT2G05630 ATG8D Ubiquitin-like superfamily pro... Lus10027186 5.7 0.9373
AT1G33780 Protein of unknown function (D... Lus10009463 6.9 0.9272
AT1G17130 Family of unknown function (DU... Lus10005575 7.1 0.9203
AT5G03560 Tetratricopeptide repeat (TPR)... Lus10027932 7.7 0.9315
AT4G28830 S-adenosyl-L-methionine-depend... Lus10011107 9.5 0.9300
AT5G52210 ATGB1, ATARLB1 GTP-binding protein 1 (.1.2) Lus10027446 10.4 0.9315

Lus10021689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.