Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62790 130 / 1e-41 NADH-ubiquinone oxidoreductase-related (.1) AT2G47690 130 / 5e-41 NADH-ubiquinone oxidoreductase-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035034 [exp] 144 / 1e-46 AT3G62790 143 / 2e-46 NADH-ubiquinone oxidoreductase-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G204800 [exp] 136 / 1e-43 AT3G62790 144 / 5e-47 NADH-ubiquinone oxidoreductase-related (.1) Potri.014G129600 [exp] 135 / 3e-43 AT2G47690 153 / 5e-50 NADH-ubiquinone oxidoreductase-related (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF10200 [flax] [poplar] Ndufs5 NADH:ubiquinone oxidoreductase, NDUFS5-15kDa
Representative CDS sequence Show only first row Show all	>Lus10021691 pacid=23180275 polypeptide=Lus10021691 locus=Lus10021691.g ID=Lus10021691.BGIv1.0 annot-version=v1.0 ATGGCTTCGGGATGGGGGATCACAGGGAACAAAGGCAGATGCTACGATTTCTGGATCGATTTCAGCGAGTGTATGTCTAAATGCAGAGAGCCCAAGGACT GCGCTTTCCTTCGCGAAGACTACATGGAGTGTCTTCACCATTCCAAAGAGTTCCAGCGAAGGAACCGGATCTACAAAGAGGAGCAGCGGAAAATACGAGC TGCAGCCAGACTAGCTAAGGAAGGTGCTGCTGGTGGTGGTGGCGAGAAAGTTAGCCAGCACGCATAG
AA sequence Show only first row Show all	>Lus10021691 pacid=23180275 polypeptide=Lus10021691 locus=Lus10021691.g ID=Lus10021691.BGIv1.0 annot-version=v1.0 MASGWGITGNKGRCYDFWIDFSECMSKCREPKDCAFLREDYMECLHHSKEFQRRNRIYKEEQRKIRAAARLAKEGAAGGGGEKVSQHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10021691 [exp]	0	1
AT1G79010			Alpha-helical ferredoxin (.1)		Lus10040456 [exp]	3.2	0.8032
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10037143 [exp]	5.1	0.8156
AT1G55340			Protein of unknown function (D...		Lus10010650 [exp]	7.7	0.8187
AT5G45660			unknown protein		Lus10002778 [exp]	10.8	0.8108
AT5G64550			loricrin-related (.1)		Lus10019307 [exp]	13.4	0.7677
AT2G31410			unknown protein		Lus10035165 [exp]	14.6	0.8055
AT5G67490			unknown protein		Lus10000389 [exp]	15.3	0.7704
AT5G66090			unknown protein		Lus10028414 [exp]	16.9	0.7647
AT2G29590			Thioesterase superfamily prote...		Lus10018205 [exp]	17.3	0.7792
AT3G58630	Trihelix		sequence-specific DNA binding ...		Lus10015281 [exp]	18.7	0.7583

Compare expression of checked genes

Lus10021691 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.