Lus10021709 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G75290 83 / 6e-19 NAD(P)-binding Rossmann-fold superfamily protein (.1)
AT4G39230 76 / 2e-16 NmrA-like negative transcriptional regulator family protein (.1)
AT1G75300 72 / 6e-15 NmrA-like negative transcriptional regulator family protein (.1)
AT1G75280 71 / 1e-14 NmrA-like negative transcriptional regulator family protein (.1)
AT4G34540 69 / 5e-14 NmrA-like negative transcriptional regulator family protein (.1)
AT1G19540 59 / 2e-10 NmrA-like negative transcriptional regulator family protein (.1)
AT1G32100 56 / 2e-09 ATPRR1 pinoresinol reductase 1 (.1)
AT4G13660 52 / 4e-08 ATPRR2 pinoresinol reductase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035058 242 / 4e-80 AT1G75290 212 / 2e-66 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10032470 158 / 6e-47 AT1G75290 226 / 2e-71 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Lus10042968 99 / 2e-25 AT1G75280 100 / 2e-24 NmrA-like negative transcriptional regulator family protein (.1)
Lus10040442 81 / 3e-18 AT4G39230 462 / 2e-165 NmrA-like negative transcriptional regulator family protein (.1)
Lus10042311 81 / 3e-18 AT4G39230 489 / 4e-176 NmrA-like negative transcriptional regulator family protein (.1)
Lus10042313 80 / 5e-18 AT4G39230 369 / 2e-129 NmrA-like negative transcriptional regulator family protein (.1)
Lus10026348 80 / 6e-18 AT4G39230 442 / 2e-157 NmrA-like negative transcriptional regulator family protein (.1)
Lus10023557 80 / 2e-17 AT4G39230 461 / 2e-162 NmrA-like negative transcriptional regulator family protein (.1)
Lus10026350 77 / 9e-17 AT4G39230 454 / 3e-162 NmrA-like negative transcriptional regulator family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G116500 202 / 2e-64 AT1G75290 242 / 3e-78 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.010G129800 192 / 1e-60 AT1G75290 241 / 2e-77 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.015G050200 165 / 4e-50 AT1G75290 257 / 6e-84 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Potri.009G118100 73 / 2e-15 AT4G39230 501 / 0.0 NmrA-like negative transcriptional regulator family protein (.1)
Potri.002G034400 72 / 6e-15 AT1G75280 467 / 2e-167 NmrA-like negative transcriptional regulator family protein (.1)
Potri.009G118000 69 / 4e-14 AT4G34540 432 / 7e-154 NmrA-like negative transcriptional regulator family protein (.1)
Potri.005G228700 68 / 1e-13 AT1G75280 451 / 3e-161 NmrA-like negative transcriptional regulator family protein (.1)
Potri.013G103701 67 / 3e-13 AT1G75280 271 / 4e-90 NmrA-like negative transcriptional regulator family protein (.1)
Potri.009G118300 66 / 5e-13 AT4G39230 488 / 8e-176 NmrA-like negative transcriptional regulator family protein (.1)
Potri.007G036500 65 / 1e-12 AT4G39230 407 / 1e-143 NmrA-like negative transcriptional regulator family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF05368 NmrA NmrA-like family
Representative CDS sequence
>Lus10021709 pacid=23180317 polypeptide=Lus10021709 locus=Lus10021709.g ID=Lus10021709.BGIv1.0 annot-version=v1.0
ATGGGCGAAGGAGGTGTTGCCGATCGAGTTCAACGGACGGGGGAGGCGGCTTCGGGAAAAACCCTAGCCGCATTGAAGGCCTCTCAACAGGAGGAAATCC
TAAATTCTACAAATCACAATATAATAATTCAATGCTGCAATTCTATAGCTTCTTGGCCTTACTACGACAATACACACCCTTCAGACGTCTCTCCTCCCAT
TGACCACCTTCCCATCTACGCCGACGGCTCCATCAAAGCTTACTTAGTGACGGGACCTGACATTGGCAAGTTTGCCATCAAGGCTCTCGACAATGATCTC
ACCATCAACAAGTCAGTCCATTTCCGACCGGATGTGAACTACTACAACATGAGCGGAGCTGGCTTCACTGTGGGAGAAGAAGATAGGAAGGCGCATCCCT
CGAAGAATCAAATTCCGGAGAGCATTGTGGCATCTTTCACCCACGACATATTCGTAAAGGGCTATCAATCTAATTTCGAGATCAATGGGGTCAACGATCT
GGAAGCCAGCGCTCTGTACCCGGATGAAGCTTTCGAGACCGTTGATCAAGTGTTCAGTGACTTTGCTCTCACAGTCCAACAGCAATAA
AA sequence
>Lus10021709 pacid=23180317 polypeptide=Lus10021709 locus=Lus10021709.g ID=Lus10021709.BGIv1.0 annot-version=v1.0
MGEGGVADRVQRTGEAASGKTLAALKASQQEEILNSTNHNIIIQCCNSIASWPYYDNTHPSDVSPPIDHLPIYADGSIKAYLVTGPDIGKFAIKALDNDL
TINKSVHFRPDVNYYNMSGAGFTVGEEDRKAHPSKNQIPESIVASFTHDIFVKGYQSNFEINGVNDLEASALYPDEAFETVDQVFSDFALTVQQQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G75290 NAD(P)-binding Rossmann-fold s... Lus10021709 0 1
AT4G39950 CYP79B2 "cytochrome P450, family 79, s... Lus10031726 1.0 0.9986
AT1G75980 Single hybrid motif superfamil... Lus10017287 1.4 0.9764
AT1G07520 GRAS GRAS family transcription fact... Lus10037757 3.9 0.9073
AT1G16290 unknown protein Lus10037104 4.2 0.8568
Lus10024757 5.0 0.8963
AT4G39610 Protein of unknown function, D... Lus10036630 5.5 0.8468
AT2G25700 ASK3 SKP1-like 3 (.1) Lus10043288 6.5 0.8885
AT1G65820 microsomal glutathione s-trans... Lus10020792 6.6 0.8965
Lus10022950 6.7 0.8331
Lus10014474 6.9 0.8935

Lus10021709 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.