Lus10021715 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G26100 211 / 8e-69 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 137 / 1e-39 ACYB-1 cytochrome B561-1 (.1)
AT4G25570 105 / 2e-27 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G14730 74 / 6e-16 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003076 140 / 2e-41 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10038866 132 / 1e-37 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 133 / 2e-37 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10039216 127 / 6e-36 AT4G25570 305 / 6e-106 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034074 126 / 8e-35 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10027461 110 / 5e-29 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 81 / 4e-18 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10034427 77 / 7e-17 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 69 / 1e-13 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G131100 232 / 9e-77 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 230 / 6e-76 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.017G111700 147 / 2e-43 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.004G103800 141 / 2e-41 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 116 / 1e-31 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.012G141000 110 / 1e-29 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.015G143700 107 / 3e-28 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G102400 77 / 4e-17 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 77 / 6e-17 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10021715 pacid=23180341 polypeptide=Lus10021715 locus=Lus10021715.g ID=Lus10021715.BGIv1.0 annot-version=v1.0
ATGGCTCCATCCCATCCATTTACACTTCCATTTCTCCTCTTAGCCAGAATCTCTGGTCTCACTGTTGCAGCTTTACTCCTCTACTGGGCTCTCCTTTCCT
ACTCTTCCTCTCAACATTCCCTCGTTTACGCTGTAAAAGCAGATCAAGCTCGGCATCCGCTGCTGATGGTGATCGGTTTCATTCTTGTCAGTGGAGAAGC
AATTCTGGTACACAGATGGCTGCCCTGTTCGAGGAACGGGAGGAAATTGGTGCATCTGGGTCTGCAAGGAGTGGCTTTGAGCTGTGGGGTGTTAGGGTTG
TGGACTAAATTCCATGGGAGTAAGGGGTTTTGGGCAAACTTCTTAAGCTTGCATTCCTGGATGGGATTGCTCTGCATTTCCTTGTTTGCTGCCCAGTGGC
TGATGGGGATGGTGAGCTTCTGGTACAGAGGGGAGATCATGCGAACGGTAAGGATGAGCAGATTGCCATGGCACATCTTTGTTGGACTCTACACTTACGC
TCTTGCAATTGCTACTGCTGAGACTGGCCTTCTCGAGAGGATCACTTCCCGGCAAATGAAAGCCAATTCTACTGTTTCCAAACGTTCTCCAGAATCATTG
GTTGCGAATGGATTAGGAGTAGGGTTGTTTTTGCTTGCTGGACTCCTAATATCGGCTGCAATTTCTCCTAAGCACCAACGTAAACCTCTCTATTCTCTGC
CAACAAACCTCAAGTGTTTGTCTTCCTGA
AA sequence
>Lus10021715 pacid=23180341 polypeptide=Lus10021715 locus=Lus10021715.g ID=Lus10021715.BGIv1.0 annot-version=v1.0
MAPSHPFTLPFLLLARISGLTVAALLLYWALLSYSSSQHSLVYAVKADQARHPLLMVIGFILVSGEAILVHRWLPCSRNGRKLVHLGLQGVALSCGVLGL
WTKFHGSKGFWANFLSLHSWMGLLCISLFAAQWLMGMVSFWYRGEIMRTVRMSRLPWHIFVGLYTYALAIATAETGLLERITSRQMKANSTVSKRSPESL
VANGLGVGLFLLAGLLISAAISPKHQRKPLYSLPTNLKCLSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G26100 Cytochrome b561/ferric reducta... Lus10021715 0 1
Lus10025143 2.0 0.8022
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10015109 4.7 0.7665
AT3G12550 FDM3 factor of DNA methylation 3, X... Lus10000950 8.5 0.7319
AT4G18593 dual specificity protein phosp... Lus10013914 11.4 0.7649
AT1G15220 ATCCMH cytochrome c biogenesis protei... Lus10038941 11.5 0.6743
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Lus10017690 18.2 0.7274
AT2G31450 ATNTH1 DNA glycosylase superfamily pr... Lus10027037 19.2 0.7628
AT3G48670 RDM12, IDN2 RNA-DIRECTED DNA METHYLATION 1... Lus10000951 20.2 0.7489
AT1G19240 unknown protein Lus10034891 21.2 0.7225
AT5G23050 AAE17 acyl-activating enzyme 17 (.1) Lus10027257 26.8 0.7082

Lus10021715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.