Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G02050 213 / 1e-67 STP7 sugar transporter protein 7 (.1) AT1G77210 182 / 6e-56 AtSTP14 sugar transport protein 14, sugar transporter 14 (.1.2) AT5G26340 174 / 9e-53 ATSTP13, MSS1, STP13 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) AT1G50310 167 / 8e-50 ATSTP9 sugar transporter 9 (.1) AT3G19940 166 / 1e-49 Major facilitator superfamily protein (.1) AT5G23270 156 / 6e-46 ATSTP11, STP11 sugar transporter 11 (.1) AT5G26250 156 / 9e-46 Major facilitator superfamily protein (.1) AT3G05960 151 / 7e-44 ATSTP6 sugar transporter 6 (.1) AT1G11260 150 / 2e-43 ATSTP1, STP1 sugar transporter 1 (.1) AT3G19930 149 / 5e-43 ATSTP4, STP4 sugar transporter 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036325 [exp] 237 / 9e-77 AT4G02050 801 / 0.0 sugar transporter protein 7 (.1) Lus10019070 [exp] 234 / 2e-76 AT4G02050 538 / 0.0 sugar transporter protein 7 (.1) Lus10022421 [exp] 174 / 1e-52 AT1G77210 790 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Lus10040993 [exp] 167 / 9e-51 AT1G50310 601 / 0.0 sugar transporter 9 (.1) Lus10002450 [exp] 168 / 3e-50 AT5G26340 905 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10010534 [exp] 168 / 4e-50 AT5G26340 902 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10013441 [exp] 167 / 5e-50 AT1G50310 731 / 0.0 sugar transporter 9 (.1) Lus10021924 [exp] 165 / 5e-49 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1) Lus10009656 [exp] 155 / 2e-45 AT5G61520 608 / 0.0 Major facilitator superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G113300 [exp] 223 / 3e-71 AT4G02050 821 / 0.0 sugar transporter protein 7 (.1) Potri.006G189100 [exp] 218 / 2e-69 AT4G02050 821 / 0.0 sugar transporter protein 7 (.1) Potri.001G253800 [exp] 189 / 3e-58 AT1G77210 737 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Potri.018G085200 [exp] 181 / 2e-55 AT1G77210 771 / 0.0 sugar transport protein 14, sugar transporter 14 (.1.2) Potri.007G072800 [exp] 178 / 5e-54 AT3G19940 672 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073850 [exp] 172 / 5e-52 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073800 [exp] 172 / 5e-52 AT3G19940 699 / 0.0 Major facilitator superfamily protein (.1) Potri.005G090700 [exp] 172 / 1e-51 AT3G19940 710 / 0.0 Major facilitator superfamily protein (.1) Potri.007G073900 [exp] 171 / 2e-51 AT3G19940 706 / 0.0 Major facilitator superfamily protein (.1) Potri.008G151100 [exp] 168 / 3e-50 AT5G26340 832 / 0.0 SUGAR TRANSPORT PROTEIN 13, Major facilitator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [flax] [poplar] MFS PF00083 [flax] [poplar] Sugar_tr Sugar (and other) transporter
Representative CDS sequence Show only first row Show all	>Lus10021723 pacid=23154319 polypeptide=Lus10021723 locus=Lus10021723.g ID=Lus10021723.BGIv1.0 annot-version=v1.0 ATGAAAGTATCGTTGAATGCTGCAGCCGTCCATATAGCAATGCTCCTGGTAGGCCGCATCTTGCTGGGCATTGGAAATAGATTCGGGAATCAGGCTGTTC CACTATATCTATTAGAAATGGCACCAACCCATCTCCGAGGAGGACTGGATATGCTGTTTCAGTTGGCGACAACTCTTGGGATCTTCTCAGCAAACATGGT CAACTATGGAACACATAAACTTGAGCCTTGGGGTTGGAGGTTATCATTGGGATTGGCAGCAGTTCCAGCTTTGCTAATGGCAATAGGTGGAATGCTGCTT CCTGAGACACCTAACAGTTTGATTGAAAGAGGGTTAGAAGAGAAAGGAAGGAAGGTACTGGAGAAAATCAGAGGAACAACCAATGTAGAAGCAGAGTTCG AGGATGGAAGTATATCGATCGAAACATCAACTAGTTTATATTCTTCAATGCTTCAATCTTTAGCTCTGCATCTGTAA
AA sequence Show only first row Show all	>Lus10021723 pacid=23154319 polypeptide=Lus10021723 locus=Lus10021723.g ID=Lus10021723.BGIv1.0 annot-version=v1.0 MKVSLNAAAVHIAMLLVGRILLGIGNRFGNQAVPLYLLEMAPTHLRGGLDMLFQLATTLGIFSANMVNYGTHKLEPWGWRLSLGLAAVPALLMAIGGMLL PETPNSLIERGLEEKGRKVLEKIRGTTNVEAEFEDGSISIETSTSLYSSMLQSLALHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10021723 [exp]	0	1
					Lus10022170 [exp]	10.0	0.7083
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10028845 [exp]	10.2	0.6943
AT4G33830			Glycosyl hydrolase family 10 p...		Lus10014645 [exp]	11.4	0.6718
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	20.1	0.7061
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10018525 [exp]	20.8	0.7425
AT3G47090			Leucine-rich repeat protein ki...		Lus10003071 [exp]	23.2	0.7265
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10003264 [exp]	33.5	0.6064
AT3G57230	MADS	AGL16	AGAMOUS-like 16 (.1.2)		Lus10029557 [exp]	43.1	0.5992
AT5G48450		SKS3	SKU5 similar 3 (.1)		Lus10040424 [exp]	47.4	0.6209
AT3G49070			Protein of unknown function (D...		Lus10018879 [exp]	51.2	0.6238

Compare expression of checked genes

Lus10021723 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.