Lus10021726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036641 61 / 1e-12 ND /
Lus10015774 62 / 2e-12 ND /
Lus10016933 60 / 4e-12 ND /
Lus10033146 61 / 6e-12 ND /
Lus10007182 54 / 8e-10 ND /
Lus10001186 56 / 9e-10 ND /
Lus10009869 52 / 7e-09 ND /
Lus10006149 52 / 1e-08 ND /
Lus10021734 51 / 1e-08 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021726 pacid=23154333 polypeptide=Lus10021726 locus=Lus10021726.g ID=Lus10021726.BGIv1.0 annot-version=v1.0
ATGACCCGTCGTCACTATCCTCGAGCTATACACGAATCTTTAACGGCAAGAACGGTCACCCCAACATCTTTACAGTGCAGATCGGAAGGTGCATCGTCTC
CACTCTCTACTGGAAAAGGGTCTTACCCGTCGTCACTCTCGTCCCCGATTGCGGTGTTTGGTTCGAGTTCAAGGAACACACAAAGGCCTCTCCCTCCTAC
AGTTCAAGTCGAGGATCCGGTCATGCGACAGTTTACAAAAGTTTATGCTTTCGGAGTTTTAGAAGCAAACTGGTACTCTCTCTCTCCCCCCGAGTTGCAT
GTGATGGCTAGAGTTATGGAAGGTTTTGGACATGTACTGGGCTCATATGGATCTATAACCCCCTCTAGCGGATCATCGGGAGCTTCTAGAGTAAAGAGGC
CTACCGATAGTAGCCCAGTAGTTGTGGAGGAGAGGGAGGAGGATGATGATGAAGACGAGGAGGTCCGCTGTTACTTTGACAGCGGATTATATCCCCTGTT
AGTTTAA
AA sequence
>Lus10021726 pacid=23154333 polypeptide=Lus10021726 locus=Lus10021726.g ID=Lus10021726.BGIv1.0 annot-version=v1.0
MTRRHYPRAIHESLTARTVTPTSLQCRSEGASSPLSTGKGSYPSSLSSPIAVFGSSSRNTQRPLPPTVQVEDPVMRQFTKVYAFGVLEANWYSLSPPELH
VMARVMEGFGHVLGSYGSITPSSGSSGASRVKRPTDSSPVVVEEREEDDDEDEEVRCYFDSGLYPLLV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021726 0 1
AT5G55480 GPDL1, GDPDL4, ... glycerophosphodiesterase-like ... Lus10018042 3.5 0.9084
AT5G01300 PEBP (phosphatidylethanolamine... Lus10002212 5.3 0.8867
Lus10016134 5.9 0.8732
AT5G28010 Polyketide cyclase/dehydrase a... Lus10002175 10.6 0.8776
AT5G10530 Concanavalin A-like lectin pro... Lus10007073 13.1 0.8538
AT2G30540 Thioredoxin superfamily protei... Lus10040899 14.2 0.8823
AT2G35740 ATINT3 nositol transporter 3 (.1) Lus10017559 17.3 0.8396
AT1G17050 SPS2 solanesyl diphosphate synthase... Lus10042491 18.7 0.8613
AT3G54200 Late embryogenesis abundant (L... Lus10031555 18.7 0.8472
AT3G60720 PDLP8 plasmodesmata-located protein ... Lus10036497 19.6 0.8716

Lus10021726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.