Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G66400 48 / 4e-08 CML23 calmodulin like 23 (.1) AT3G03410 46 / 1e-07 EF hand calcium-binding protein family (.1) AT5G37770 46 / 3e-07 CML24, TCH2 TOUCH 2, CALMODULIN-LIKE 24, EF hand calcium-binding protein family (.1) AT5G37780 46 / 3e-07 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT1G66410 46 / 3e-07 ACAM-4, CAM4 calmodulin 4 (.1.2) AT3G56800 45 / 3e-07 ACAM-3, CAM3 calmodulin 3 (.1) AT2G27030 45 / 3e-07 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT2G41110 45 / 3e-07 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT3G43810 45 / 3e-07 CAM7 calmodulin 7 (.1) AT5G42380 46 / 4e-07 CML39, CML37 CALMODULIN LIKE 39, calmodulin like 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019863 [exp] 51 / 4e-09 AT2G15680 233 / 9e-79 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10014050 [exp] 51 / 6e-09 AT2G15680 239 / 4e-81 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Lus10009059 [exp] 50 / 1e-08 AT1G18210 197 / 3e-65 Calcium-binding EF-hand family protein (.1.2) Lus10031345 [exp] 50 / 2e-08 AT1G18210 196 / 1e-64 Calcium-binding EF-hand family protein (.1.2) Lus10042008 [exp] 47 / 8e-08 AT1G18210 138 / 1e-42 Calcium-binding EF-hand family protein (.1.2) Lus10018012 [exp] 46 / 3e-07 AT1G18210 195 / 2e-64 Calcium-binding EF-hand family protein (.1.2) Lus10027283 [exp] 45 / 4e-07 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 45 / 4e-07 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 45 / 4e-07 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G030500 [exp] 126 / 2e-39 ND / Potri.014G030900 [exp] 124 / 9e-39 AT1G66400 41 / 2e-05 calmodulin like 23 (.1) Potri.014G030800 [exp] 117 / 6e-36 AT3G03430 40 / 9e-06 Calcium-binding EF-hand family protein (.1) Potri.002G127000 [exp] 114 / 1e-34 AT4G25970 44 / 2e-06 phosphatidylserine decarboxylase 3 (.1) Potri.014G030700 [exp] 96 / 2e-27 ND / Potri.007G042700 [exp] 81 / 1e-21 AT3G20410 42 / 2e-05 calmodulin-domain protein kinase 9 (.1) Potri.002G126900 [exp] 54 / 6e-11 AT4G26470 40 / 4e-05 Calcium-binding EF-hand family protein (.1.2) Potri.007G042900 [exp] 52 / 2e-09 AT2G15680 169 / 1e-53 calmodulin-like 30, Calcium-binding EF-hand family protein (.1) Potri.004G089200 [exp] 48 / 8e-09 AT3G03430 128 / 2e-40 Calcium-binding EF-hand family protein (.1) Potri.006G026700 [exp] 45 / 3e-07 AT3G43810 300 / 2e-106 calmodulin 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [flax] [poplar] EF_hand PF00036 [flax] [poplar] EF-hand_1 EF hand
Representative CDS sequence Show only first row Show all	>Lus10021732 pacid=23154324 polypeptide=Lus10021732 locus=Lus10021732.g ID=Lus10021732.BGIv1.0 annot-version=v1.0 ATGGCAATCAAGACGAGAAACATTTCTCTCGATGGGAAGCGGGAAATGACGTTGCCAGAGTTCAAAGCATGGCTAAGGAGGTTCGACGTCGACCATGACG GTAAGATAAGCAGACAAGAGCTTGCCGACGCCGTCCGGGCATCCGGCGGAAGGTTCGCCAGGTGGAAGTGCCGCCAGGGTCTACGGTCAGCGGATTCCGA CGGCAACGGCTTCATCGACGCCAACGAGTTCAACAACCTTGTTGATTTCGCACACAAACACCTAGGTGTCAAGATCATCTATTTCTGA
AA sequence Show only first row Show all	>Lus10021732 pacid=23154324 polypeptide=Lus10021732 locus=Lus10021732.g ID=Lus10021732.BGIv1.0 annot-version=v1.0 MAIKTRNISLDGKREMTLPEFKAWLRRFDVDHDGKISRQELADAVRASGGRFARWKCRQGLRSADSDGNGFIDANEFNNLVDFAHKHLGVKIIYF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G66400		CML23	calmodulin like 23 (.1)		Lus10021732 [exp]	0	1
					Lus10036864 [exp]	1.0	0.8810
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10001640 [exp]	9.5	0.8332
AT2G43870			Pectin lyase-like superfamily ...		Lus10011419 [exp]	14.3	0.7741
					Lus10006216 [exp]	16.2	0.8056
AT4G12410			SAUR-like auxin-responsive pro...		Lus10024600 [exp]	17.0	0.8219
AT2G43870			Pectin lyase-like superfamily ...		Lus10002123 [exp]	22.9	0.7711
AT1G49570			Peroxidase superfamily protein...		Lus10023858 [exp]	24.5	0.7730
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10039277 [exp]	37.1	0.7888
					Lus10041324 [exp]	44.6	0.7006
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10030446 [exp]	47.6	0.7961

Compare expression of checked genes

Lus10021732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.