Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38025 50 / 2e-08 Cysteine proteinases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027758 [exp] 106 / 6e-30 AT2G38025 227 / 4e-75 Cysteine proteinases superfamily protein (.1) Lus10035535 [exp] 64 / 6e-14 AT2G38025 112 / 5e-31 Cysteine proteinases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G110400 [exp] 75 / 8e-18 AT2G38025 276 / 1e-94 Cysteine proteinases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10021738 pacid=23154314 polypeptide=Lus10021738 locus=Lus10021738.g ID=Lus10021738.BGIv1.0 annot-version=v1.0 ATGAAACATGGAGCTGCTTACTTCGAGCTCGTCTCTTCGCCTCTTTCTTCCATTTCAGCTTCACCGCCGCAAACCCGCTCGTTCCCCTTCTTCTTCGCCG GCAACAATCACCGGTTCTTCGCTCGAATCGGTCCTCCACTAGGTAAAAGATTGCCATCTATGAAGAAGTTGAAGCAATGTTCAATCCAGAAAGTCAACTG TGATGGCCGCTGTCTGTTCCGTGCCTTGGTATATGTAACCTTTAATGCTGAATTCTTACGTGTTGGTGCTGATTCCTGTGGATTCGCCTGTTAA
AA sequence Show only first row Show all	>Lus10021738 pacid=23154314 polypeptide=Lus10021738 locus=Lus10021738.g ID=Lus10021738.BGIv1.0 annot-version=v1.0 MKHGAAYFELVSSPLSSISASPPQTRSFPFFFAGNNHRFFARIGPPLGKRLPSMKKLKQCSIQKVNCDGRCLFRALVYVTFNAEFLRVGADSCGFAC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38025			Cysteine proteinases superfami...		Lus10021738 [exp]	0	1
AT1G48580			unknown protein		Lus10009051 [exp]	7.3	0.8033
AT3G25160			ER lumen protein retaining rec...		Lus10022763 [exp]	31.4	0.8380
AT4G10300			RmlC-like cupins superfamily p...		Lus10037245 [exp]	60.8	0.8231
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10018378 [exp]	78.5	0.8164
AT4G35783		RTFL6, DVL17	DEVIL 17, ROTUNDIFOLIA like 6 ...		Lus10041846 [exp]	174.7	0.7855

Compare expression of checked genes

Lus10021738 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.