Lus10021739 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009076 86 / 1e-22 ND /
Lus10037474 78 / 1e-19 ND /
Lus10036275 74 / 4e-18 ND /
Lus10032865 57 / 2e-11 AT2G01050 40 / 9e-05 zinc ion binding;nucleic acid binding (.1)
Lus10003431 58 / 4e-11 ND /
Lus10042500 54 / 4e-10 ND /
Lus10002313 46 / 9e-07 ND /
Lus10032744 41 / 3e-05 ND /
Lus10004431 39 / 0.0002 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10021739 pacid=23154312 polypeptide=Lus10021739 locus=Lus10021739.g ID=Lus10021739.BGIv1.0 annot-version=v1.0
ATGGCACAGGGCCTCATAAAATCATTGCACGACTCTGACGAGGAGCTACATGTGGATAGACGTATGTCAACGACGATGATGATTATTTCATCGATGGAGG
CCTTATCCCTCGCGGACATCGTCGAACAACCACCACCATGGAGCTACGAGTATTGTATCGTAGGTAACTTCTTAACAAAGAAGGAGATCAATTTGACCCA
GGCACATCACTGTTTACCGAACACCTTGCAACCGGAGAAGGGAGTTGAGATAACCGTCATGGAGGACCATCAACTCTTGTTTCAGTTTGCTCACAAACTA
GACGTCCGACACGTGATCGACAACAAACCATGGTTCTTCAATAATCACATTCTAATCATGCATGAACTGATCCAAGGAGAAGAACCAAGGATCTGA
AA sequence
>Lus10021739 pacid=23154312 polypeptide=Lus10021739 locus=Lus10021739.g ID=Lus10021739.BGIv1.0 annot-version=v1.0
MAQGLIKSLHDSDEELHVDRRMSTTMMIISSMEALSLADIVEQPPPWSYEYCIVGNFLTKKEINLTQAHHCLPNTLQPEKGVEITVMEDHQLLFQFAHKL
DVRHVIDNKPWFFNNHILIMHELIQGEEPRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021739 0 1
AT5G02910 F-box/RNI-like superfamily pro... Lus10000727 2.2 1.0000
Lus10004437 3.2 1.0000
AT2G24370 Protein kinase protein with ad... Lus10027593 3.9 1.0000
AT3G08030 Protein of unknown function, D... Lus10029502 4.5 1.0000
AT4G02340 alpha/beta-Hydrolases superfam... Lus10038312 4.9 0.9415
AT3G18170 Glycosyltransferase family 61 ... Lus10032454 5.0 1.0000
AT1G30700 FAD-binding Berberine family p... Lus10031080 5.9 1.0000
Lus10039674 6.0 1.0000
AT2G26490 Transducin/WD40 repeat-like su... Lus10032868 6.3 1.0000
AT1G05270 TraB family protein (.1) Lus10038419 6.8 0.7789

Lus10021739 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.