Lus10021752 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010039 52 / 1e-08 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G019466 47 / 8e-07 AT3G42170 279 / 6e-82 BED zinc finger ;hAT family dimerisation domain (.1)
PFAM info
Representative CDS sequence
>Lus10021752 pacid=23154307 polypeptide=Lus10021752 locus=Lus10021752.g ID=Lus10021752.BGIv1.0 annot-version=v1.0
ATGACAAATCAACAAGTGATTGTCTTATGCTACATTTTTTCTAAAGGGTTTCCTGAAGAGGAAGTTCTATTTGATAACAGGCAACATATCCTTTGTCGAT
CTAACTTGTACACCTTACTACCTGAGAAATGGCTAAATAGCAAGGTTATAACTGCAGCATCACACCGCACAACATATTTCACAAGAGTTAAAAATGAACG
CGTAGTTTGGTACTTACCGGCAACGTTATCTAAAGATTTGATGACTAAGAGAACTCCCTATGAACAAGCTGTGAATGTGTACCGACATACAACTTTATTG
CGCAATTCAAACAACTGTTGGAAGGTCAAATTCTTATACTTCATGTTTTATGAGATGGTGCTAGCAGATAATTCGTTAGTCGAAGTCCCAAGGATCATCG
ACTTTGACATACTCTCTCCAGAGAATGTTTCAAAATAA
AA sequence
>Lus10021752 pacid=23154307 polypeptide=Lus10021752 locus=Lus10021752.g ID=Lus10021752.BGIv1.0 annot-version=v1.0
MTNQQVIVLCYIFSKGFPEEEVLFDNRQHILCRSNLYTLLPEKWLNSKVITAASHRTTYFTRVKNERVVWYLPATLSKDLMTKRTPYEQAVNVYRHTTLL
RNSNNCWKVKFLYFMFYEMVLADNSLVEVPRIIDFDILSPENVSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10021752 0 1
AT2G03270 DNA-binding protein, putative ... Lus10026309 6.2 0.8974
AT5G49690 UDP-Glycosyltransferase superf... Lus10027850 8.4 0.9035
AT5G28470 Major facilitator superfamily ... Lus10042182 8.9 0.8786
AT2G29420 GST25, ATGSTU7 GLUTATHIONE S-TRANSFERASE 25, ... Lus10040761 23.4 0.8916
AT5G12340 unknown protein Lus10009698 24.7 0.8536
AT4G27420 ABCG9 ATP-binding cassette G9, ABC-2... Lus10025596 25.8 0.8766
AT3G21690 MATE efflux family protein (.1... Lus10027169 33.7 0.8542
AT2G47000 PGP4 ,MDR4, ABC... MULTIDRUG RESISTANCE 4, ARABID... Lus10038050 34.4 0.8868
AT1G80730 C2H2ZnF ATZFP1, ZFP1 ARABIDOPSIS THALIANA ZINC-FING... Lus10014350 36.3 0.8873
AT4G34710 SPE2, ADC2, ATA... arginine decarboxylase 2 (.1.2... Lus10035463 49.2 0.8491

Lus10021752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.