Plant FIBer expression Database

Lus10021764 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06430 223 / 1e-74 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032763
[exp]
230 / 2e-78 AT5G06430 152 / 1e-47 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G035300
[exp]
226 / 9e-76 AT5G06430 251 / 1e-85 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10021764 pacid=23154313 polypeptide=Lus10021764 locus=Lus10021764.g ID=Lus10021764.BGIv1.0 annot-version=v1.0
ATGAAAACCGACGCAGCTCCTCCAAAGCATCCTCTCTTCTGTCTAACATGGCCTTGGGACCAGAATCACAAAACTAGCCCCAACGCCTGCTCCTACGAGG
GTCCATGGCTGTTGAAATCCCTCAGCACTCTGGGATCCATTGCCCTAAAATCGATAAACTCGGTCTCCAATTCGTCGGCGAATAGGAAAGGAAAGAGAAG
TCCGGAAGAGCAGGCTGAGGCGGAGCAAAGAGCGTTTGCATCGGCTCTGGCTAGCGGGAAAGAGGCAACGGTGCTTGAATTTTACTCCCCCAAGTGTATG
CTCTGCAACTCATTGGTCAATTTGGTGACGGAGGTGGAGAGGAGGAACTCGGATTGGGTCAACATTGTGATGGCCGATGCAGAGAACGAACAATGGCTAC
CTGAGCTGCTGCATTATGACATAAAGTACGTACCTTGCTTTGTAATGCTGGACAAGAATGGAAAGGCAGTGGGGAAAACAGGGGTTCCAAGCAGTAGGTT
GCATGTGGTTGCTGGCATCTCTCATCTTCTCAAGCTCAAGCGTCCTCCTTCTACTTTTGGCCCATAG
AA sequence
>Lus10021764 pacid=23154313 polypeptide=Lus10021764 locus=Lus10021764.g ID=Lus10021764.BGIv1.0 annot-version=v1.0
MKTDAAPPKHPLFCLTWPWDQNHKTSPNACSYEGPWLLKSLSTLGSIALKSINSVSNSSANRKGKRSPEEQAEAEQRAFASALASGKEATVLEFYSPKCM
LCNSLVNLVTEVERRNSDWVNIVMADAENEQWLPELLHYDIKYVPCFVMLDKNGKAVGKTGVPSSRLHVVAGISHLLKLKRPPSTFGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06430 Thioredoxin superfamily protei... Lus10021764
[exp]
0 1
AT3G49080 Ribosomal protein S5 domain 2-... Lus10038852
[exp]
5.7 0.7058
AT5G53420 CCT motif family protein (.1.2... Lus10027344
[exp]
7.3 0.6566
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Lus10016665
[exp]
12.8 0.7241
AT1G80880 Tetratricopeptide repeat (TPR)... Lus10041669
[exp]
21.1 0.6806
AT3G06200 P-loop containing nucleoside t... Lus10021947
[exp]
23.7 0.6900
AT5G05180 unknown protein Lus10012861
[exp]
26.6 0.6841
AT5G12100 pentatricopeptide (PPR) repeat... Lus10014365
[exp]
36.2 0.6564
AT4G28310 unknown protein Lus10033688
[exp]
37.5 0.6780
AT2G44650 CHL-CPN10 chloroplast chaperonin 10 (.1) Lus10019497
[exp]
39.2 0.6793
AT5G09995 unknown protein Lus10035858
[exp]
46.0 0.6657

Lus10021764 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.