Lus10021764 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G06430 223 / 1e-74 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032763 230 / 2e-78 AT5G06430 152 / 1e-47 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G035300 226 / 9e-76 AT5G06430 251 / 1e-85 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00085 Thioredoxin Thioredoxin
Representative CDS sequence
>Lus10021764 pacid=23154313 polypeptide=Lus10021764 locus=Lus10021764.g ID=Lus10021764.BGIv1.0 annot-version=v1.0
ATGAAAACCGACGCAGCTCCTCCAAAGCATCCTCTCTTCTGTCTAACATGGCCTTGGGACCAGAATCACAAAACTAGCCCCAACGCCTGCTCCTACGAGG
GTCCATGGCTGTTGAAATCCCTCAGCACTCTGGGATCCATTGCCCTAAAATCGATAAACTCGGTCTCCAATTCGTCGGCGAATAGGAAAGGAAAGAGAAG
TCCGGAAGAGCAGGCTGAGGCGGAGCAAAGAGCGTTTGCATCGGCTCTGGCTAGCGGGAAAGAGGCAACGGTGCTTGAATTTTACTCCCCCAAGTGTATG
CTCTGCAACTCATTGGTCAATTTGGTGACGGAGGTGGAGAGGAGGAACTCGGATTGGGTCAACATTGTGATGGCCGATGCAGAGAACGAACAATGGCTAC
CTGAGCTGCTGCATTATGACATAAAGTACGTACCTTGCTTTGTAATGCTGGACAAGAATGGAAAGGCAGTGGGGAAAACAGGGGTTCCAAGCAGTAGGTT
GCATGTGGTTGCTGGCATCTCTCATCTTCTCAAGCTCAAGCGTCCTCCTTCTACTTTTGGCCCATAG
AA sequence
>Lus10021764 pacid=23154313 polypeptide=Lus10021764 locus=Lus10021764.g ID=Lus10021764.BGIv1.0 annot-version=v1.0
MKTDAAPPKHPLFCLTWPWDQNHKTSPNACSYEGPWLLKSLSTLGSIALKSINSVSNSSANRKGKRSPEEQAEAEQRAFASALASGKEATVLEFYSPKCM
LCNSLVNLVTEVERRNSDWVNIVMADAENEQWLPELLHYDIKYVPCFVMLDKNGKAVGKTGVPSSRLHVVAGISHLLKLKRPPSTFGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G06430 Thioredoxin superfamily protei... Lus10021764 0 1
AT3G49080 Ribosomal protein S5 domain 2-... Lus10038852 5.7 0.7058
AT5G53420 CCT motif family protein (.1.2... Lus10027344 7.3 0.6566
AT3G07130 ATPAP15, PAP15 purple acid phosphatase 15 (.1... Lus10016665 12.8 0.7241
AT1G80880 Tetratricopeptide repeat (TPR)... Lus10041669 21.1 0.6806
AT3G06200 P-loop containing nucleoside t... Lus10021947 23.7 0.6900
AT5G05180 unknown protein Lus10012861 26.6 0.6841
AT5G12100 pentatricopeptide (PPR) repeat... Lus10014365 36.2 0.6564
AT4G28310 unknown protein Lus10033688 37.5 0.6780
AT2G44650 CHL-CPN10 chloroplast chaperonin 10 (.1) Lus10019497 39.2 0.6793
AT5G09995 unknown protein Lus10035858 46.0 0.6657

Lus10021764 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.